Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A517L504

Protein Details
Accession A0A517L504   
Localization Confidence Medium
Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
138-163EEDKTAKKAAPKKEKKEPAKGTRASSBasic
NLS Segment(s)
PositionSequence
61-122KNEPKKGAPTPKSDKKKGDEVKDGSAKKDEKKTSSKEEKKTSGKAEKKPATKVAKKNSKAEK
142-167TAKKAAPKKEKKEPAKGTRASSRVAK
Subcellular Location(s) cyto_nucl 10, mito 8, nucl 17
Family & Domain DBs
Amino Acid Sequences MPSSKGKPTDPKLREKVKEDVKQDTNKDGGGKGQWSAWKAAKLSKEYEAKGGSYENEAGSKNEPKKGAPTPKSDKKKGDEVKDGSAKKDEKKTSSKEEKKTSGKAEKKPATKVAKKNSKAEKEAEKEEEQEEQGEGEEEDKTAKKAAPKKEKKEPAKGTRASSRVAKREAVDYDETEETESKKSKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.73
3 0.74
4 0.74
5 0.76
6 0.69
7 0.69
8 0.67
9 0.67
10 0.65
11 0.6
12 0.51
13 0.45
14 0.43
15 0.34
16 0.29
17 0.25
18 0.23
19 0.19
20 0.21
21 0.22
22 0.22
23 0.26
24 0.26
25 0.27
26 0.26
27 0.31
28 0.33
29 0.33
30 0.34
31 0.37
32 0.39
33 0.37
34 0.4
35 0.36
36 0.31
37 0.29
38 0.27
39 0.2
40 0.17
41 0.17
42 0.13
43 0.13
44 0.14
45 0.14
46 0.16
47 0.23
48 0.24
49 0.27
50 0.27
51 0.26
52 0.31
53 0.38
54 0.45
55 0.43
56 0.48
57 0.54
58 0.63
59 0.7
60 0.71
61 0.68
62 0.62
63 0.68
64 0.66
65 0.63
66 0.61
67 0.56
68 0.56
69 0.57
70 0.53
71 0.44
72 0.43
73 0.39
74 0.35
75 0.4
76 0.36
77 0.35
78 0.41
79 0.44
80 0.48
81 0.57
82 0.61
83 0.6
84 0.64
85 0.67
86 0.65
87 0.65
88 0.63
89 0.62
90 0.61
91 0.6
92 0.64
93 0.63
94 0.62
95 0.61
96 0.63
97 0.62
98 0.62
99 0.64
100 0.64
101 0.68
102 0.68
103 0.73
104 0.73
105 0.71
106 0.66
107 0.63
108 0.61
109 0.56
110 0.56
111 0.53
112 0.44
113 0.39
114 0.37
115 0.34
116 0.26
117 0.21
118 0.17
119 0.12
120 0.11
121 0.09
122 0.08
123 0.07
124 0.07
125 0.06
126 0.08
127 0.09
128 0.1
129 0.11
130 0.13
131 0.2
132 0.27
133 0.38
134 0.47
135 0.57
136 0.64
137 0.73
138 0.82
139 0.83
140 0.86
141 0.86
142 0.85
143 0.85
144 0.81
145 0.77
146 0.75
147 0.69
148 0.62
149 0.6
150 0.59
151 0.56
152 0.54
153 0.52
154 0.45
155 0.49
156 0.48
157 0.44
158 0.39
159 0.33
160 0.34
161 0.31
162 0.3
163 0.26
164 0.25
165 0.21
166 0.24