Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A517LH05

Protein Details
Accession A0A517LH05    Localization Confidence High Confidence Score 17.2
NoLS Segment(s)
PositionSequenceProtein Nature
199-222LAKVSMKRNPREKAQRRKEIADRAHydrophilic
227-256RIQAEKAAEKERKKKEHKKRVAAYNDEWFDHydrophilic
NLS Segment(s)
PositionSequence
37-120SKPKPEAAKAEKAASEAESKAPSKAPAKEPCKAPSKAPSKASTKAPSKASSKAPSQASIKAPSKAPAKAPSKAPTKPPSKTEPK
204-246MKRNPREKAQRRKEIADRAAKQDRIQAEKAAEKERKKKEHKKR
Subcellular Location(s) nucl 18, cyto_nucl 10.5, mito 6
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MQSPFAQTLHLQINQKSSTPPGPRSLHVKLVSARQISKPKPEAAKAEKAASEAESKAPSKAPAKEPCKAPSKAPSKASTKAPSKASSKAPSQASIKAPSKAPAKAPSKAPTKPPSKTEPKAPTQAPSQASARPPSQALTKVPSKASTKPPTKPPFKASCLTGSTKPSPMQAVITATCGLIGAIAGPAGVAVGLASGVALAKVSMKRNPREKAQRRKEIADRAAKQDRIQAEKAAEKERKKKEHKKRVAAYNDEWFDTCLDYT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.38
3 0.35
4 0.34
5 0.37
6 0.4
7 0.42
8 0.44
9 0.46
10 0.48
11 0.54
12 0.53
13 0.53
14 0.48
15 0.49
16 0.43
17 0.47
18 0.51
19 0.47
20 0.45
21 0.44
22 0.51
23 0.5
24 0.56
25 0.54
26 0.54
27 0.56
28 0.57
29 0.59
30 0.57
31 0.63
32 0.56
33 0.55
34 0.48
35 0.43
36 0.4
37 0.32
38 0.28
39 0.2
40 0.2
41 0.2
42 0.2
43 0.2
44 0.21
45 0.23
46 0.26
47 0.31
48 0.36
49 0.43
50 0.47
51 0.52
52 0.55
53 0.57
54 0.6
55 0.55
56 0.51
57 0.51
58 0.53
59 0.54
60 0.54
61 0.54
62 0.52
63 0.55
64 0.58
65 0.57
66 0.55
67 0.54
68 0.53
69 0.51
70 0.49
71 0.5
72 0.49
73 0.46
74 0.43
75 0.44
76 0.41
77 0.4
78 0.39
79 0.4
80 0.36
81 0.39
82 0.38
83 0.34
84 0.33
85 0.34
86 0.35
87 0.32
88 0.33
89 0.34
90 0.36
91 0.37
92 0.41
93 0.43
94 0.46
95 0.46
96 0.5
97 0.49
98 0.52
99 0.51
100 0.51
101 0.52
102 0.55
103 0.55
104 0.57
105 0.55
106 0.53
107 0.55
108 0.52
109 0.46
110 0.4
111 0.43
112 0.35
113 0.31
114 0.28
115 0.25
116 0.25
117 0.26
118 0.23
119 0.18
120 0.17
121 0.16
122 0.17
123 0.17
124 0.17
125 0.18
126 0.21
127 0.22
128 0.22
129 0.25
130 0.26
131 0.28
132 0.36
133 0.41
134 0.44
135 0.46
136 0.56
137 0.61
138 0.64
139 0.63
140 0.62
141 0.6
142 0.59
143 0.57
144 0.49
145 0.45
146 0.42
147 0.41
148 0.37
149 0.34
150 0.32
151 0.32
152 0.31
153 0.27
154 0.25
155 0.22
156 0.2
157 0.16
158 0.17
159 0.14
160 0.15
161 0.14
162 0.12
163 0.11
164 0.1
165 0.08
166 0.05
167 0.05
168 0.03
169 0.03
170 0.03
171 0.03
172 0.02
173 0.02
174 0.02
175 0.02
176 0.02
177 0.02
178 0.02
179 0.02
180 0.02
181 0.02
182 0.02
183 0.02
184 0.02
185 0.02
186 0.02
187 0.06
188 0.1
189 0.13
190 0.19
191 0.27
192 0.35
193 0.44
194 0.49
195 0.56
196 0.64
197 0.72
198 0.78
199 0.81
200 0.84
201 0.81
202 0.83
203 0.81
204 0.8
205 0.78
206 0.77
207 0.7
208 0.68
209 0.7
210 0.65
211 0.57
212 0.53
213 0.5
214 0.46
215 0.45
216 0.4
217 0.36
218 0.4
219 0.42
220 0.46
221 0.47
222 0.49
223 0.57
224 0.63
225 0.7
226 0.75
227 0.82
228 0.85
229 0.89
230 0.92
231 0.93
232 0.92
233 0.92
234 0.91
235 0.88
236 0.82
237 0.8
238 0.72
239 0.63
240 0.54
241 0.44
242 0.35