Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A517L9T4

Protein Details
Accession A0A517L9T4    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
95-119KELGILTKKKKWREKGKKGGCVWTLHydrophilic
NLS Segment(s)
PositionSequence
102-112KKKKWREKGKK
Subcellular Location(s) cyto 11.5, cyto_nucl 6.5, E.R. 5, mito 4, plas 3
Family & Domain DBs
Amino Acid Sequences MDSVAVGELAIGELAIGELAIGELAIGEFATGEFATGEFATGEFATGEFATGEFATGELAVGELAIGGLAVGVLAAGDVRERVDCWLYFSAGWFKELGILTKKKKWREKGKKGGCVWTLVSF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.03
3 0.02
4 0.02
5 0.02
6 0.02
7 0.02
8 0.02
9 0.02
10 0.02
11 0.02
12 0.02
13 0.02
14 0.02
15 0.02
16 0.02
17 0.04
18 0.04
19 0.04
20 0.04
21 0.04
22 0.06
23 0.05
24 0.06
25 0.05
26 0.05
27 0.06
28 0.06
29 0.06
30 0.05
31 0.05
32 0.06
33 0.06
34 0.06
35 0.05
36 0.05
37 0.06
38 0.06
39 0.06
40 0.05
41 0.05
42 0.05
43 0.04
44 0.04
45 0.03
46 0.03
47 0.02
48 0.02
49 0.02
50 0.02
51 0.02
52 0.02
53 0.01
54 0.01
55 0.01
56 0.01
57 0.01
58 0.01
59 0.01
60 0.01
61 0.01
62 0.01
63 0.02
64 0.02
65 0.02
66 0.03
67 0.04
68 0.04
69 0.06
70 0.09
71 0.09
72 0.14
73 0.15
74 0.15
75 0.15
76 0.17
77 0.21
78 0.19
79 0.2
80 0.15
81 0.14
82 0.18
83 0.18
84 0.2
85 0.22
86 0.29
87 0.33
88 0.41
89 0.48
90 0.54
91 0.63
92 0.7
93 0.74
94 0.78
95 0.85
96 0.88
97 0.92
98 0.92
99 0.87
100 0.86
101 0.76
102 0.69