Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A517KZQ8

Protein Details
Accession A0A517KZQ8   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
13-36YFTTEKVREHKQKKRDLKAQQTLEHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 19, cyto_nucl 11, mito 4
Family & Domain DBs
Amino Acid Sequences MASVIIALGVAAYFTTEKVREHKQKKRDLKAQQTLEGDVSTFDGTTPPYDDDEHLPTYHKEALPAYAKKDYRTPPGLV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.08
3 0.09
4 0.11
5 0.16
6 0.26
7 0.36
8 0.45
9 0.54
10 0.6
11 0.69
12 0.78
13 0.83
14 0.82
15 0.82
16 0.83
17 0.84
18 0.78
19 0.72
20 0.63
21 0.54
22 0.46
23 0.36
24 0.25
25 0.15
26 0.13
27 0.07
28 0.06
29 0.05
30 0.05
31 0.05
32 0.06
33 0.08
34 0.08
35 0.09
36 0.1
37 0.12
38 0.14
39 0.17
40 0.18
41 0.17
42 0.18
43 0.18
44 0.2
45 0.24
46 0.21
47 0.2
48 0.19
49 0.25
50 0.31
51 0.33
52 0.34
53 0.37
54 0.38
55 0.39
56 0.46
57 0.46
58 0.47