Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A517LLU7

Protein Details
Accession A0A517LLU7    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
58-78KDPKDPKKPGVGPKKHKHICCBasic
NLS Segment(s)
PositionSequence
61-74KDPKKPGVGPKKHK
Subcellular Location(s) extr 16, cyto 7, vacu 2
Family & Domain DBs
Amino Acid Sequences MQFIHLILIGLLNFATLGSAYAYSCEKPPANCKYGLKGGSWAPCTQNGCYWSKGCDPKDPKDPKKPGVGPKKHKHICCWDAGLKGEQYTDS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.03
4 0.04
5 0.04
6 0.05
7 0.05
8 0.07
9 0.09
10 0.09
11 0.1
12 0.14
13 0.15
14 0.17
15 0.25
16 0.31
17 0.32
18 0.36
19 0.37
20 0.38
21 0.42
22 0.4
23 0.33
24 0.29
25 0.29
26 0.29
27 0.29
28 0.26
29 0.21
30 0.23
31 0.24
32 0.22
33 0.22
34 0.2
35 0.21
36 0.22
37 0.21
38 0.21
39 0.25
40 0.32
41 0.3
42 0.37
43 0.4
44 0.44
45 0.54
46 0.61
47 0.62
48 0.66
49 0.71
50 0.66
51 0.7
52 0.72
53 0.71
54 0.72
55 0.75
56 0.75
57 0.78
58 0.85
59 0.82
60 0.79
61 0.77
62 0.76
63 0.7
64 0.65
65 0.63
66 0.56
67 0.52
68 0.51
69 0.47
70 0.39
71 0.35