Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A517LFH6

Protein Details
Accession A0A517LFH6    Localization Confidence High Confidence Score 16.1
NoLS Segment(s)
PositionSequenceProtein Nature
98-126TPAESKLTTEKHKKKQRHFPQRVYAVKASHydrophilic
NLS Segment(s)
PositionSequence
91-114RAMRRRLTPAESKLTTEKHKKKQR
Subcellular Location(s) nucl 21, mito 3, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MSTSKVKAAQLWTKNKEDLRKQLDELKSELVQLRTQKIAGGNTSKLTKIHDVRKSIARVLTVINANQRAQLRIFYKNKKYMPLDLRPKQTRAMRRRLTPAESKLTTEKHKKKQRHFPQRVYAVKASI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.63
3 0.64
4 0.63
5 0.64
6 0.61
7 0.6
8 0.57
9 0.6
10 0.59
11 0.53
12 0.47
13 0.41
14 0.33
15 0.31
16 0.32
17 0.25
18 0.25
19 0.25
20 0.25
21 0.22
22 0.22
23 0.22
24 0.21
25 0.21
26 0.21
27 0.22
28 0.2
29 0.22
30 0.23
31 0.22
32 0.2
33 0.2
34 0.24
35 0.26
36 0.33
37 0.37
38 0.39
39 0.41
40 0.47
41 0.46
42 0.41
43 0.37
44 0.28
45 0.23
46 0.21
47 0.21
48 0.16
49 0.15
50 0.15
51 0.15
52 0.14
53 0.17
54 0.17
55 0.15
56 0.14
57 0.18
58 0.18
59 0.25
60 0.32
61 0.37
62 0.44
63 0.5
64 0.52
65 0.54
66 0.54
67 0.54
68 0.54
69 0.56
70 0.6
71 0.58
72 0.66
73 0.63
74 0.62
75 0.6
76 0.6
77 0.61
78 0.59
79 0.63
80 0.61
81 0.62
82 0.69
83 0.68
84 0.67
85 0.65
86 0.62
87 0.6
88 0.54
89 0.52
90 0.48
91 0.47
92 0.5
93 0.53
94 0.57
95 0.6
96 0.68
97 0.75
98 0.81
99 0.87
100 0.9
101 0.9
102 0.91
103 0.9
104 0.91
105 0.91
106 0.87
107 0.83