Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A517L3K8

Protein Details
Accession A0A517L3K8    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
79-106KKKGAPRTPKTPKTPKPKAAPKEKKETABasic
NLS Segment(s)
PositionSequence
77-114TPKKKGAPRTPKTPKTPKPKAAPKEKKETAASAKKRKL
Subcellular Location(s) cyto 13.5, cyto_nucl 13, nucl 11.5
Family & Domain DBs
Amino Acid Sequences MAPISSDDTVKFLISCITCKDGDKIDFEKVSQECGIVTKAAAAKRYERVIKKAKEDDEKQKAAKEANDNGEEPPEETPKKKGAPRTPKTPKTPKPKAAPKEKKETAASAKKRKLAEVKQEEDGSAEDAEEEEKPSIFGRVEDERKAEVEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.17
3 0.18
4 0.21
5 0.21
6 0.23
7 0.26
8 0.27
9 0.28
10 0.31
11 0.3
12 0.32
13 0.32
14 0.3
15 0.34
16 0.28
17 0.3
18 0.24
19 0.22
20 0.16
21 0.17
22 0.18
23 0.11
24 0.11
25 0.1
26 0.14
27 0.15
28 0.18
29 0.19
30 0.21
31 0.25
32 0.3
33 0.34
34 0.34
35 0.41
36 0.47
37 0.5
38 0.54
39 0.57
40 0.57
41 0.58
42 0.61
43 0.63
44 0.62
45 0.61
46 0.55
47 0.5
48 0.46
49 0.4
50 0.38
51 0.33
52 0.3
53 0.3
54 0.31
55 0.29
56 0.27
57 0.26
58 0.22
59 0.18
60 0.14
61 0.14
62 0.13
63 0.13
64 0.16
65 0.19
66 0.23
67 0.26
68 0.33
69 0.39
70 0.5
71 0.54
72 0.62
73 0.68
74 0.72
75 0.78
76 0.8
77 0.79
78 0.78
79 0.82
80 0.8
81 0.8
82 0.82
83 0.81
84 0.82
85 0.84
86 0.79
87 0.8
88 0.75
89 0.71
90 0.63
91 0.6
92 0.58
93 0.58
94 0.61
95 0.6
96 0.62
97 0.62
98 0.61
99 0.61
100 0.61
101 0.59
102 0.61
103 0.61
104 0.59
105 0.59
106 0.58
107 0.52
108 0.44
109 0.36
110 0.27
111 0.17
112 0.13
113 0.09
114 0.08
115 0.09
116 0.09
117 0.1
118 0.09
119 0.09
120 0.1
121 0.1
122 0.13
123 0.12
124 0.12
125 0.16
126 0.24
127 0.29
128 0.32
129 0.34
130 0.34