Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A517LMB6

Protein Details
Accession A0A517LMB6    Localization Confidence Medium Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
16-43VNVRSVCKELKRKIPKKKARITIRLTECHydrophilic
NLS Segment(s)
PositionSequence
26-35KRKIPKKKAR
Subcellular Location(s) nucl 15, mito 10
Family & Domain DBs
Amino Acid Sequences MAIRSISSISNKNFTVNVRSVCKELKRKIPKKKARITIRLTECDSAEEDQKLLSKARTKTREEIEDTSIATYLAMVREYRVHQWPADRRRFGRAPYDEMPRLDNFAVDRHGGMAWRSERGHSTSSVIVNTNDP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.34
3 0.33
4 0.35
5 0.35
6 0.37
7 0.38
8 0.41
9 0.47
10 0.5
11 0.51
12 0.57
13 0.63
14 0.71
15 0.79
16 0.84
17 0.86
18 0.87
19 0.9
20 0.9
21 0.88
22 0.88
23 0.84
24 0.82
25 0.78
26 0.72
27 0.65
28 0.56
29 0.46
30 0.38
31 0.33
32 0.24
33 0.2
34 0.15
35 0.13
36 0.12
37 0.13
38 0.13
39 0.12
40 0.13
41 0.18
42 0.23
43 0.32
44 0.38
45 0.41
46 0.45
47 0.49
48 0.51
49 0.49
50 0.46
51 0.4
52 0.34
53 0.3
54 0.25
55 0.2
56 0.15
57 0.1
58 0.07
59 0.05
60 0.04
61 0.05
62 0.05
63 0.05
64 0.08
65 0.1
66 0.13
67 0.17
68 0.18
69 0.18
70 0.26
71 0.34
72 0.42
73 0.49
74 0.51
75 0.49
76 0.55
77 0.58
78 0.53
79 0.54
80 0.48
81 0.46
82 0.45
83 0.51
84 0.46
85 0.44
86 0.44
87 0.34
88 0.34
89 0.26
90 0.24
91 0.17
92 0.16
93 0.18
94 0.15
95 0.15
96 0.13
97 0.13
98 0.13
99 0.13
100 0.17
101 0.17
102 0.21
103 0.22
104 0.23
105 0.26
106 0.28
107 0.3
108 0.25
109 0.27
110 0.27
111 0.28
112 0.28
113 0.27