Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A517LJN5

Protein Details
Accession A0A517LJN5    Localization Confidence Low Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
47-68STSPVLQKRKKGEKKDMRITLIHydrophilic
NLS Segment(s)
PositionSequence
54-61KRKKGEKK
Subcellular Location(s) mito 21.5, cyto_mito 12, nucl 2, plas 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR019192  Ribosomal_L28/L40_mit  
IPR042831  YmL28  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09812  MRP-L28  
Amino Acid Sequences MTFSRSLSSLRAAVPALCSPKFPTTALPRTGQWQSTTPRRIQCPAFSTSPVLQKRKKGEKKDMRITLIRYFLLHPKAPRVLRLSRLRSLRHWTIHRAWQLHKAKLRRQRELDLERQYNEMRRACEELRLIGSNGLPGGKDEGKLFRTAMMKRDVWQGVPIEYARIQTEWPSKDGWNHGWTRG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.23
3 0.25
4 0.23
5 0.23
6 0.25
7 0.29
8 0.3
9 0.28
10 0.31
11 0.35
12 0.42
13 0.45
14 0.43
15 0.4
16 0.43
17 0.46
18 0.41
19 0.34
20 0.32
21 0.35
22 0.42
23 0.46
24 0.46
25 0.49
26 0.51
27 0.53
28 0.51
29 0.51
30 0.45
31 0.45
32 0.42
33 0.37
34 0.37
35 0.35
36 0.4
37 0.41
38 0.44
39 0.43
40 0.47
41 0.55
42 0.62
43 0.68
44 0.68
45 0.73
46 0.76
47 0.82
48 0.85
49 0.82
50 0.75
51 0.7
52 0.65
53 0.58
54 0.5
55 0.4
56 0.31
57 0.27
58 0.27
59 0.27
60 0.26
61 0.22
62 0.23
63 0.29
64 0.29
65 0.31
66 0.31
67 0.3
68 0.36
69 0.44
70 0.45
71 0.44
72 0.48
73 0.47
74 0.45
75 0.49
76 0.46
77 0.43
78 0.41
79 0.41
80 0.4
81 0.44
82 0.44
83 0.4
84 0.37
85 0.41
86 0.45
87 0.45
88 0.46
89 0.46
90 0.49
91 0.56
92 0.61
93 0.59
94 0.58
95 0.58
96 0.62
97 0.62
98 0.62
99 0.61
100 0.56
101 0.49
102 0.47
103 0.43
104 0.38
105 0.38
106 0.33
107 0.27
108 0.27
109 0.31
110 0.28
111 0.31
112 0.28
113 0.24
114 0.24
115 0.24
116 0.22
117 0.18
118 0.18
119 0.14
120 0.13
121 0.11
122 0.08
123 0.08
124 0.12
125 0.11
126 0.12
127 0.14
128 0.18
129 0.19
130 0.21
131 0.2
132 0.2
133 0.25
134 0.26
135 0.29
136 0.31
137 0.31
138 0.31
139 0.39
140 0.36
141 0.31
142 0.33
143 0.3
144 0.24
145 0.26
146 0.24
147 0.19
148 0.19
149 0.2
150 0.18
151 0.17
152 0.16
153 0.2
154 0.28
155 0.28
156 0.28
157 0.29
158 0.3
159 0.35
160 0.41
161 0.4
162 0.4