Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A559M9V5

Protein Details
Accession A0A559M9V5   
Localization Confidence Low
Confidence Score 6.3
NoLS Segment(s)
PositionSequenceProtein Nature
21-42PSSQWHPPSRSQRRHASERDYEHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 2, cyto_nucl 3, cyto_pero 2, extr 2, golg 2, mito 3, nucl 4, pero 2, plas 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR023395  Mt_carrier_dom_sf  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
Amino Acid Sequences MQYPSDESDPDEPAYFTSSAPSSQWHPPSRSQRRHASERDYEKDYSPPPSPKGISIPPHQLSLKRVDSIMEVISQLWNKEGAWGVWKATNATFVYSLLLQTIEQWSRGLFSAAFNVPEAAVTTGINLSAELLDTPYPWASLAVAVAAAVSAGLILAPLDLIRTKLILTPLSSTKRSLSHNLRNLPSYLCPTPLMVPTILHSLITPTVNHSTPLLLRSYLGIDPILTPTTYSISKCLSQTTELFLRLPFETILRRGQMAVLATPLYQSEDGKRLETIVDIGPYHGVLGTMWSIVLEEGGSSSLVNAKKGKWAETKGQGVEGLWRGWRVGMWGLVGMWGARALGGSGANGGEF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.2
3 0.16
4 0.17
5 0.17
6 0.17
7 0.17
8 0.19
9 0.2
10 0.28
11 0.36
12 0.4
13 0.43
14 0.52
15 0.62
16 0.71
17 0.76
18 0.76
19 0.78
20 0.79
21 0.84
22 0.82
23 0.8
24 0.79
25 0.78
26 0.76
27 0.7
28 0.64
29 0.56
30 0.54
31 0.47
32 0.43
33 0.4
34 0.41
35 0.39
36 0.44
37 0.43
38 0.4
39 0.44
40 0.46
41 0.45
42 0.45
43 0.51
44 0.46
45 0.49
46 0.48
47 0.44
48 0.41
49 0.43
50 0.4
51 0.32
52 0.31
53 0.27
54 0.27
55 0.26
56 0.23
57 0.16
58 0.13
59 0.12
60 0.14
61 0.14
62 0.13
63 0.12
64 0.11
65 0.1
66 0.12
67 0.13
68 0.11
69 0.14
70 0.15
71 0.15
72 0.17
73 0.18
74 0.17
75 0.16
76 0.2
77 0.17
78 0.18
79 0.17
80 0.15
81 0.16
82 0.14
83 0.13
84 0.09
85 0.09
86 0.07
87 0.08
88 0.12
89 0.11
90 0.12
91 0.12
92 0.11
93 0.12
94 0.13
95 0.13
96 0.08
97 0.08
98 0.12
99 0.13
100 0.14
101 0.12
102 0.12
103 0.11
104 0.11
105 0.11
106 0.07
107 0.06
108 0.06
109 0.06
110 0.06
111 0.06
112 0.06
113 0.05
114 0.05
115 0.04
116 0.04
117 0.04
118 0.05
119 0.05
120 0.05
121 0.06
122 0.06
123 0.06
124 0.06
125 0.06
126 0.05
127 0.05
128 0.05
129 0.04
130 0.04
131 0.04
132 0.03
133 0.03
134 0.02
135 0.02
136 0.02
137 0.01
138 0.01
139 0.01
140 0.01
141 0.01
142 0.02
143 0.02
144 0.02
145 0.02
146 0.03
147 0.04
148 0.04
149 0.04
150 0.05
151 0.07
152 0.09
153 0.09
154 0.1
155 0.12
156 0.17
157 0.2
158 0.21
159 0.2
160 0.21
161 0.23
162 0.25
163 0.3
164 0.34
165 0.39
166 0.45
167 0.49
168 0.49
169 0.46
170 0.45
171 0.38
172 0.31
173 0.27
174 0.2
175 0.16
176 0.15
177 0.15
178 0.16
179 0.15
180 0.15
181 0.11
182 0.11
183 0.11
184 0.13
185 0.12
186 0.1
187 0.09
188 0.08
189 0.1
190 0.1
191 0.09
192 0.1
193 0.13
194 0.13
195 0.14
196 0.13
197 0.13
198 0.13
199 0.14
200 0.12
201 0.09
202 0.09
203 0.1
204 0.12
205 0.11
206 0.1
207 0.09
208 0.08
209 0.08
210 0.1
211 0.1
212 0.07
213 0.07
214 0.07
215 0.1
216 0.11
217 0.11
218 0.12
219 0.13
220 0.16
221 0.16
222 0.18
223 0.17
224 0.18
225 0.19
226 0.22
227 0.22
228 0.21
229 0.21
230 0.19
231 0.2
232 0.17
233 0.18
234 0.13
235 0.12
236 0.14
237 0.16
238 0.19
239 0.18
240 0.18
241 0.17
242 0.17
243 0.17
244 0.16
245 0.13
246 0.11
247 0.1
248 0.1
249 0.1
250 0.1
251 0.1
252 0.09
253 0.1
254 0.12
255 0.18
256 0.19
257 0.2
258 0.2
259 0.18
260 0.18
261 0.17
262 0.16
263 0.12
264 0.13
265 0.12
266 0.12
267 0.12
268 0.12
269 0.11
270 0.09
271 0.07
272 0.05
273 0.07
274 0.07
275 0.06
276 0.06
277 0.06
278 0.06
279 0.06
280 0.06
281 0.04
282 0.03
283 0.04
284 0.05
285 0.05
286 0.05
287 0.05
288 0.11
289 0.12
290 0.15
291 0.18
292 0.18
293 0.25
294 0.28
295 0.34
296 0.37
297 0.42
298 0.47
299 0.53
300 0.59
301 0.53
302 0.53
303 0.47
304 0.39
305 0.39
306 0.33
307 0.26
308 0.21
309 0.2
310 0.19
311 0.19
312 0.18
313 0.15
314 0.16
315 0.15
316 0.14
317 0.14
318 0.14
319 0.14
320 0.14
321 0.11
322 0.08
323 0.07
324 0.06
325 0.05
326 0.05
327 0.05
328 0.06
329 0.07
330 0.07
331 0.08