Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A559M4I8

Protein Details
Accession A0A559M4I8   
Localization Confidence High
Confidence Score 18.4
NoLS Segment(s)
PositionSequenceProtein Nature
225-248ADEDPKPKRGRGRPRKTQSSSADQHydrophilic
NLS Segment(s)
PositionSequence
83-138KKRAEEKVKEVEAVKKEKEAAKKEKEAAKKEKEEAKKESAGAAKDGKRKREKEPSQ
146-158NPPVKRGRGRPRK
202-240AKSPLPNIKATRSPVPKAAKAPVADEDPKPKRGRGRPRK
Subcellular Location(s) cyto_nucl 13.5, nucl 23.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR017956  AT_hook_DNA-bd_motif  
IPR009061  DNA-bd_dom_put_sf  
IPR037129  XPA_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Amino Acid Sequences MPPLKTGTCDTCSTEKVTLRPNPFTQKEQCDDCRDASIIGVTELKTQFKLKDDDLKDLEMVTEPKPAFLGGPDRRWYLVEQVKKRAEEKVKEVEAVKKEKEAAKKEKEAAKKEKEEAKKESAGAAKDGKRKREKEPSQGENAEEVNPPVKRGRGRPRKVIQGTSSSASNSPLPKAAEDLSSPAAKTPGLPKVGILSLPPKAAKSPLPNIKATRSPVPKAAKAPVADEDPKPKRGRGRPRKTQSSSADQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.37
3 0.38
4 0.44
5 0.47
6 0.48
7 0.53
8 0.55
9 0.59
10 0.6
11 0.63
12 0.62
13 0.62
14 0.61
15 0.62
16 0.61
17 0.58
18 0.57
19 0.51
20 0.47
21 0.4
22 0.34
23 0.27
24 0.23
25 0.17
26 0.14
27 0.15
28 0.12
29 0.16
30 0.17
31 0.18
32 0.18
33 0.2
34 0.22
35 0.24
36 0.28
37 0.26
38 0.34
39 0.35
40 0.41
41 0.4
42 0.4
43 0.35
44 0.31
45 0.28
46 0.2
47 0.2
48 0.13
49 0.18
50 0.16
51 0.16
52 0.16
53 0.16
54 0.13
55 0.14
56 0.23
57 0.21
58 0.26
59 0.29
60 0.3
61 0.31
62 0.32
63 0.31
64 0.3
65 0.32
66 0.35
67 0.38
68 0.45
69 0.48
70 0.49
71 0.49
72 0.49
73 0.49
74 0.45
75 0.46
76 0.46
77 0.43
78 0.43
79 0.43
80 0.41
81 0.39
82 0.39
83 0.34
84 0.27
85 0.29
86 0.31
87 0.37
88 0.39
89 0.42
90 0.44
91 0.48
92 0.53
93 0.56
94 0.59
95 0.6
96 0.6
97 0.59
98 0.56
99 0.57
100 0.59
101 0.59
102 0.58
103 0.55
104 0.51
105 0.45
106 0.41
107 0.4
108 0.34
109 0.28
110 0.25
111 0.25
112 0.25
113 0.31
114 0.34
115 0.38
116 0.44
117 0.47
118 0.52
119 0.58
120 0.6
121 0.63
122 0.69
123 0.65
124 0.63
125 0.61
126 0.54
127 0.44
128 0.39
129 0.3
130 0.21
131 0.17
132 0.14
133 0.13
134 0.14
135 0.13
136 0.16
137 0.18
138 0.27
139 0.38
140 0.45
141 0.51
142 0.6
143 0.64
144 0.71
145 0.72
146 0.68
147 0.6
148 0.55
149 0.52
150 0.43
151 0.38
152 0.29
153 0.25
154 0.21
155 0.21
156 0.17
157 0.15
158 0.17
159 0.17
160 0.16
161 0.18
162 0.17
163 0.16
164 0.15
165 0.17
166 0.16
167 0.16
168 0.16
169 0.14
170 0.14
171 0.12
172 0.13
173 0.15
174 0.19
175 0.2
176 0.2
177 0.2
178 0.22
179 0.23
180 0.22
181 0.19
182 0.16
183 0.16
184 0.19
185 0.19
186 0.17
187 0.18
188 0.2
189 0.25
190 0.28
191 0.36
192 0.42
193 0.46
194 0.5
195 0.52
196 0.55
197 0.55
198 0.53
199 0.53
200 0.51
201 0.5
202 0.53
203 0.57
204 0.56
205 0.55
206 0.55
207 0.51
208 0.46
209 0.46
210 0.41
211 0.4
212 0.39
213 0.38
214 0.42
215 0.42
216 0.48
217 0.48
218 0.5
219 0.53
220 0.6
221 0.68
222 0.69
223 0.75
224 0.79
225 0.87
226 0.93
227 0.89
228 0.89