Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A559LYS9

Protein Details
Accession A0A559LYS9    Localization Confidence Low Confidence Score 6.8
NoLS Segment(s)
PositionSequenceProtein Nature
63-85IKRVLQDKRFKVRTKWRSWKGDCHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, nucl 5.5, cyto_nucl 4.833, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR011009  Kinase-like_dom_sf  
IPR017441  Protein_kinase_ATP_BS  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005524  F:ATP binding  
GO:0016301  F:kinase activity  
GO:0016310  P:phosphorylation  
PROSITE View protein in PROSITE  
PS00107  PROTEIN_KINASE_ATP  
Amino Acid Sequences MSQNRPAAFSSLRMGEVIREKVQDGVTGETRDMQYTQCKIVGNGSFGVVFQTKLSPSGEDAAIKRVLQDKRFKVRTKWRSWKGDC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.19
3 0.24
4 0.25
5 0.23
6 0.22
7 0.22
8 0.24
9 0.25
10 0.23
11 0.19
12 0.18
13 0.19
14 0.19
15 0.19
16 0.18
17 0.18
18 0.16
19 0.15
20 0.13
21 0.15
22 0.16
23 0.17
24 0.17
25 0.17
26 0.16
27 0.2
28 0.2
29 0.16
30 0.15
31 0.14
32 0.12
33 0.11
34 0.13
35 0.09
36 0.08
37 0.07
38 0.08
39 0.07
40 0.09
41 0.1
42 0.09
43 0.1
44 0.12
45 0.12
46 0.14
47 0.14
48 0.17
49 0.17
50 0.17
51 0.17
52 0.22
53 0.27
54 0.31
55 0.4
56 0.45
57 0.54
58 0.63
59 0.66
60 0.69
61 0.75
62 0.79
63 0.81
64 0.83
65 0.83