Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A559M0D2

Protein Details
Accession A0A559M0D2   
Localization Confidence Medium
Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
80-110LASKIEKPSRQQRKQRKNRQKTLRGTAKVKGHydrophilic
NLS Segment(s)
PositionSequence
83-117KIEKPSRQQRKQRKNRQKTLRGTAKVKGAKKKKDS
Subcellular Location(s) cyto 6.5, cyto_nucl 12, mito 2, nucl 16.5, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences MNLANSGDSDVLHPNRANISKDDLRAKLAEMYKATVAQVNVFGLQTQFGGGKTTGFALVYDSPDALKKFEPHYRLVRVGLASKIEKPSRQQRKQRKNRQKTLRGTAKVKGAKKKKDS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.27
3 0.31
4 0.32
5 0.27
6 0.34
7 0.35
8 0.39
9 0.43
10 0.38
11 0.37
12 0.35
13 0.34
14 0.32
15 0.29
16 0.28
17 0.23
18 0.24
19 0.22
20 0.22
21 0.21
22 0.17
23 0.15
24 0.12
25 0.12
26 0.1
27 0.1
28 0.09
29 0.09
30 0.07
31 0.07
32 0.06
33 0.05
34 0.05
35 0.05
36 0.07
37 0.07
38 0.07
39 0.07
40 0.07
41 0.07
42 0.06
43 0.06
44 0.07
45 0.08
46 0.08
47 0.08
48 0.08
49 0.08
50 0.1
51 0.1
52 0.09
53 0.1
54 0.12
55 0.16
56 0.21
57 0.23
58 0.26
59 0.32
60 0.34
61 0.35
62 0.34
63 0.32
64 0.28
65 0.28
66 0.24
67 0.22
68 0.19
69 0.2
70 0.25
71 0.26
72 0.27
73 0.31
74 0.41
75 0.49
76 0.58
77 0.65
78 0.71
79 0.79
80 0.88
81 0.93
82 0.94
83 0.94
84 0.95
85 0.95
86 0.94
87 0.92
88 0.92
89 0.91
90 0.87
91 0.8
92 0.75
93 0.73
94 0.71
95 0.69
96 0.69
97 0.68