Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A559M157

Protein Details
Accession A0A559M157   
Localization Confidence High
Confidence Score 15.7
NoLS Segment(s)
PositionSequenceProtein Nature
11-30ATAPQPKKHKSKFNIGPDNLHydrophilic
33-57GTYRRKVIKIKKRLNPQSQSKKNHTHydrophilic
NLS Segment(s)
PositionSequence
37-45RKVIKIKKR
Subcellular Location(s) cyto_nucl 12.5, mito 4, nucl 22
Family & Domain DBs
Amino Acid Sequences MAPKRPIEDDATAPQPKKHKSKFNIGPDNLPDGTYRRKVIKIKKRLNPQSQSKKNHTQNSRPATQTLHPPPHPLPPNPNENQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.43
3 0.47
4 0.52
5 0.55
6 0.58
7 0.6
8 0.7
9 0.75
10 0.79
11 0.81
12 0.72
13 0.69
14 0.6
15 0.59
16 0.48
17 0.39
18 0.29
19 0.22
20 0.25
21 0.23
22 0.23
23 0.21
24 0.27
25 0.33
26 0.42
27 0.5
28 0.56
29 0.62
30 0.67
31 0.75
32 0.8
33 0.82
34 0.81
35 0.81
36 0.82
37 0.82
38 0.82
39 0.78
40 0.79
41 0.78
42 0.79
43 0.76
44 0.74
45 0.74
46 0.74
47 0.72
48 0.63
49 0.56
50 0.51
51 0.47
52 0.48
53 0.47
54 0.49
55 0.44
56 0.48
57 0.49
58 0.54
59 0.57
60 0.52
61 0.53
62 0.5