Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A559M798

Protein Details
Accession A0A559M798    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
148-173LVVHCKKEGAPQPKKKGKKAGQEGEEBasic
NLS Segment(s)
PositionSequence
157-167APQPKKKGKKA
Subcellular Location(s) cyto_nucl 13.666, nucl 12.5, cyto 12.5, cyto_mito 7.499, mito_nucl 7.499
Family & Domain DBs
InterPro View protein in InterPro  
IPR046522  DUF6699  
Pfam View protein in Pfam  
PF20415  DUF6699  
Amino Acid Sequences MSADVPTPLSKVDSAVQGLSSSPPKEKRRASSSVPGVFNINDLEKEGTELLIAKETQKLNWRINKSPALLEDPEKSALKKMLTTPPVKKIDLHFPLGLEVSARNLRGVTIKDALDAIYKQYRKKADDELENPILAGFEWDKEESWTRLVVHCKKEGAPQPKKKGKKAGQEGEEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.18
3 0.18
4 0.16
5 0.17
6 0.18
7 0.19
8 0.18
9 0.23
10 0.32
11 0.37
12 0.46
13 0.52
14 0.58
15 0.6
16 0.65
17 0.65
18 0.66
19 0.68
20 0.67
21 0.61
22 0.53
23 0.48
24 0.41
25 0.35
26 0.27
27 0.19
28 0.12
29 0.12
30 0.13
31 0.11
32 0.12
33 0.11
34 0.1
35 0.09
36 0.09
37 0.08
38 0.09
39 0.09
40 0.09
41 0.14
42 0.14
43 0.17
44 0.24
45 0.29
46 0.33
47 0.41
48 0.45
49 0.45
50 0.5
51 0.53
52 0.46
53 0.43
54 0.37
55 0.34
56 0.3
57 0.28
58 0.24
59 0.21
60 0.22
61 0.2
62 0.19
63 0.16
64 0.17
65 0.16
66 0.16
67 0.17
68 0.22
69 0.26
70 0.31
71 0.32
72 0.38
73 0.41
74 0.4
75 0.38
76 0.34
77 0.38
78 0.36
79 0.36
80 0.28
81 0.24
82 0.25
83 0.23
84 0.2
85 0.11
86 0.08
87 0.08
88 0.09
89 0.09
90 0.09
91 0.08
92 0.09
93 0.12
94 0.13
95 0.14
96 0.15
97 0.15
98 0.15
99 0.15
100 0.15
101 0.14
102 0.13
103 0.13
104 0.17
105 0.19
106 0.21
107 0.27
108 0.32
109 0.33
110 0.36
111 0.42
112 0.42
113 0.49
114 0.5
115 0.52
116 0.48
117 0.45
118 0.41
119 0.32
120 0.25
121 0.16
122 0.15
123 0.08
124 0.07
125 0.1
126 0.1
127 0.11
128 0.14
129 0.18
130 0.17
131 0.18
132 0.2
133 0.19
134 0.23
135 0.32
136 0.37
137 0.39
138 0.41
139 0.43
140 0.43
141 0.5
142 0.54
143 0.56
144 0.59
145 0.64
146 0.71
147 0.79
148 0.85
149 0.85
150 0.87
151 0.85
152 0.85
153 0.86
154 0.85