Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A559M6R6

Protein Details
Accession A0A559M6R6    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
165-187YRLAKKLSRSKISSRRRRNLLAIHydrophilic
NLS Segment(s)
PositionSequence
59-67KKPSKKGPG
147-182RRPKKRARGFIRAYAPSSYRLAKKLSRSKISSRRRR
Subcellular Location(s) nucl 11, cyto_nucl 10.5, cyto 8, mito 6
Family & Domain DBs
Amino Acid Sequences MASQPMRHGSASNEAVSIMTLSIFRRNYAITDQIIGFAIKGIVSGVGLVSESIKANEAKKPSKKGPGRGADVDAGDSRIQNEEILQEQGDEEEWDLKELVPQTSDKAKQTRDLIVIVQQFVLKYSLLQVNDPVAVAKLAFPVILPQRRPKKRARGFIRAYAPSSYRLAKKLSRSKISSRRRRNLLAIIWIGEAEHPESFLAQGPEDKFSSRYADPHLFYI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.22
3 0.21
4 0.18
5 0.09
6 0.07
7 0.07
8 0.08
9 0.15
10 0.16
11 0.16
12 0.17
13 0.18
14 0.2
15 0.23
16 0.26
17 0.21
18 0.23
19 0.22
20 0.21
21 0.21
22 0.19
23 0.14
24 0.1
25 0.09
26 0.06
27 0.06
28 0.05
29 0.04
30 0.04
31 0.04
32 0.04
33 0.04
34 0.04
35 0.04
36 0.04
37 0.05
38 0.06
39 0.06
40 0.08
41 0.1
42 0.12
43 0.17
44 0.23
45 0.31
46 0.37
47 0.44
48 0.48
49 0.57
50 0.62
51 0.66
52 0.7
53 0.68
54 0.68
55 0.62
56 0.59
57 0.5
58 0.44
59 0.36
60 0.27
61 0.2
62 0.15
63 0.12
64 0.1
65 0.1
66 0.1
67 0.08
68 0.08
69 0.08
70 0.09
71 0.1
72 0.09
73 0.08
74 0.07
75 0.07
76 0.07
77 0.06
78 0.05
79 0.07
80 0.07
81 0.07
82 0.08
83 0.07
84 0.09
85 0.1
86 0.1
87 0.09
88 0.09
89 0.11
90 0.16
91 0.18
92 0.19
93 0.22
94 0.23
95 0.26
96 0.28
97 0.29
98 0.25
99 0.24
100 0.21
101 0.21
102 0.21
103 0.17
104 0.15
105 0.13
106 0.11
107 0.11
108 0.11
109 0.07
110 0.06
111 0.08
112 0.11
113 0.11
114 0.11
115 0.11
116 0.11
117 0.12
118 0.12
119 0.09
120 0.06
121 0.06
122 0.06
123 0.05
124 0.05
125 0.05
126 0.05
127 0.04
128 0.08
129 0.15
130 0.2
131 0.22
132 0.3
133 0.41
134 0.48
135 0.53
136 0.58
137 0.63
138 0.68
139 0.76
140 0.76
141 0.76
142 0.75
143 0.78
144 0.76
145 0.67
146 0.61
147 0.53
148 0.45
149 0.37
150 0.35
151 0.31
152 0.26
153 0.26
154 0.29
155 0.31
156 0.4
157 0.47
158 0.53
159 0.57
160 0.59
161 0.67
162 0.73
163 0.79
164 0.8
165 0.81
166 0.82
167 0.81
168 0.82
169 0.78
170 0.75
171 0.69
172 0.65
173 0.56
174 0.48
175 0.4
176 0.34
177 0.28
178 0.2
179 0.17
180 0.11
181 0.09
182 0.08
183 0.08
184 0.09
185 0.09
186 0.13
187 0.13
188 0.12
189 0.17
190 0.18
191 0.22
192 0.22
193 0.23
194 0.21
195 0.22
196 0.27
197 0.24
198 0.26
199 0.3
200 0.36