Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A559M0B0

Protein Details
Accession A0A559M0B0    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
100-122GAPQWGKKAKVRQRKVVKRIQEAHydrophilic
NLS Segment(s)
PositionSequence
106-115KKAKVRQRKV
Subcellular Location(s) cyto 8, cyto_nucl 8, cysk 8, nucl 6, pero 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR011431  Trafficking_Pga2  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF07543  PGA2  
Amino Acid Sequences MAELLLATWERLTNVPTHLIHSVDNMTLKNWIRLVAIVGTYMLIRPYFIKLSARQQEKQFEKIDAETTASMAKIQPNALRDSKGSAVEIQESDSEGEADGAPQWGKKAKVRQRKVVKRIQEAIEEKGREDDESNSILDQFVDYEEGVDGW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.2
3 0.2
4 0.23
5 0.23
6 0.23
7 0.22
8 0.22
9 0.22
10 0.18
11 0.19
12 0.16
13 0.15
14 0.2
15 0.21
16 0.21
17 0.2
18 0.19
19 0.18
20 0.18
21 0.19
22 0.14
23 0.13
24 0.11
25 0.1
26 0.09
27 0.08
28 0.08
29 0.07
30 0.05
31 0.06
32 0.07
33 0.09
34 0.1
35 0.12
36 0.15
37 0.17
38 0.27
39 0.34
40 0.38
41 0.4
42 0.43
43 0.5
44 0.5
45 0.52
46 0.45
47 0.38
48 0.34
49 0.31
50 0.29
51 0.2
52 0.18
53 0.13
54 0.12
55 0.11
56 0.09
57 0.08
58 0.07
59 0.08
60 0.08
61 0.09
62 0.1
63 0.12
64 0.16
65 0.16
66 0.17
67 0.16
68 0.18
69 0.18
70 0.17
71 0.16
72 0.13
73 0.13
74 0.13
75 0.13
76 0.11
77 0.1
78 0.09
79 0.09
80 0.08
81 0.08
82 0.06
83 0.07
84 0.05
85 0.06
86 0.05
87 0.06
88 0.06
89 0.06
90 0.08
91 0.11
92 0.14
93 0.19
94 0.29
95 0.38
96 0.49
97 0.56
98 0.65
99 0.73
100 0.81
101 0.84
102 0.83
103 0.82
104 0.79
105 0.79
106 0.72
107 0.69
108 0.62
109 0.58
110 0.57
111 0.48
112 0.41
113 0.37
114 0.34
115 0.27
116 0.26
117 0.23
118 0.19
119 0.2
120 0.2
121 0.17
122 0.16
123 0.15
124 0.14
125 0.11
126 0.08
127 0.08
128 0.09
129 0.08
130 0.09