Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A559LYM0

Protein Details
Accession A0A559LYM0   
Localization Confidence Medium
Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
145-174TEAEPMRTKEKKKRRNRRINTVKSKHKFTIBasic
NLS Segment(s)
PositionSequence
151-170RTKEKKKRRNRRINTVKSKH
Subcellular Location(s) cyto 9.5, cyto_nucl 11, mito 7, nucl 9.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036164  L21-like_sf  
IPR028909  L21p-like  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF00829  Ribosomal_L21p  
Amino Acid Sequences ARYFNSTVQHVDAPSESLDASVLATNTSAEAPETVAPVRRPIRPKVPLPPAPISQPIALDASVKEMLPLLAAQPSHYISAHIHAKPYLVTAGDTVRLPFHMPGVVPGDILRLNRASSLGSRDYTLKGTPYLDERVFECRARVMGTEAEPMRTKEKKKRRNRRINTVKSKHKFTILKIAEIKINSLEDIEGSGESV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.17
3 0.13
4 0.11
5 0.1
6 0.08
7 0.09
8 0.08
9 0.08
10 0.07
11 0.07
12 0.07
13 0.08
14 0.08
15 0.07
16 0.06
17 0.06
18 0.08
19 0.08
20 0.1
21 0.1
22 0.14
23 0.15
24 0.22
25 0.25
26 0.31
27 0.35
28 0.4
29 0.49
30 0.52
31 0.57
32 0.59
33 0.65
34 0.65
35 0.66
36 0.64
37 0.56
38 0.52
39 0.5
40 0.43
41 0.34
42 0.28
43 0.22
44 0.18
45 0.16
46 0.14
47 0.1
48 0.12
49 0.12
50 0.11
51 0.1
52 0.09
53 0.09
54 0.08
55 0.08
56 0.05
57 0.06
58 0.06
59 0.07
60 0.08
61 0.09
62 0.1
63 0.1
64 0.11
65 0.09
66 0.14
67 0.19
68 0.18
69 0.18
70 0.17
71 0.17
72 0.16
73 0.17
74 0.12
75 0.07
76 0.07
77 0.07
78 0.07
79 0.08
80 0.08
81 0.08
82 0.07
83 0.07
84 0.08
85 0.07
86 0.07
87 0.06
88 0.06
89 0.08
90 0.11
91 0.1
92 0.1
93 0.09
94 0.1
95 0.11
96 0.11
97 0.1
98 0.08
99 0.08
100 0.08
101 0.09
102 0.09
103 0.09
104 0.13
105 0.14
106 0.14
107 0.14
108 0.16
109 0.17
110 0.18
111 0.17
112 0.14
113 0.13
114 0.13
115 0.14
116 0.15
117 0.19
118 0.17
119 0.18
120 0.18
121 0.22
122 0.23
123 0.23
124 0.2
125 0.16
126 0.17
127 0.17
128 0.17
129 0.14
130 0.15
131 0.16
132 0.21
133 0.2
134 0.22
135 0.23
136 0.24
137 0.28
138 0.32
139 0.38
140 0.42
141 0.53
142 0.61
143 0.7
144 0.8
145 0.85
146 0.9
147 0.93
148 0.94
149 0.94
150 0.95
151 0.95
152 0.94
153 0.93
154 0.88
155 0.86
156 0.77
157 0.75
158 0.68
159 0.61
160 0.63
161 0.54
162 0.56
163 0.52
164 0.51
165 0.46
166 0.42
167 0.39
168 0.31
169 0.29
170 0.21
171 0.18
172 0.16
173 0.12
174 0.12
175 0.12