Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A559LY12

Protein Details
Accession A0A559LY12   
Localization Confidence Low
Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
142-164WQEKKLCRALRRRGNLVQHRERLHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 7.5, cyto_nucl 11, mito 3, nucl 11.5, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR033468  Metaxin_GST  
Pfam View protein in Pfam  
PF17171  GST_C_6  
CDD cd03193  GST_C_Metaxin  
Amino Acid Sequences NKLVKYAEEQGKTVEESSSMRYEAYQSLIDHRIRDAWLYTLYLEPLNFSAVAYHLYVSPASTNPLVRASISHQLRSAAEAELLTHTAIIDTDDLYSEADKAFEALSILLGEDSWFFGTAKPTLFDASIFAYTQLLLDDELGWQEKKLCRALRRRGNLVQHRERLLVRYFGGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.17
3 0.16
4 0.2
5 0.2
6 0.18
7 0.17
8 0.16
9 0.18
10 0.18
11 0.19
12 0.18
13 0.16
14 0.21
15 0.27
16 0.28
17 0.26
18 0.25
19 0.25
20 0.22
21 0.23
22 0.19
23 0.15
24 0.15
25 0.15
26 0.15
27 0.14
28 0.14
29 0.14
30 0.12
31 0.11
32 0.1
33 0.1
34 0.09
35 0.08
36 0.08
37 0.07
38 0.09
39 0.08
40 0.08
41 0.07
42 0.08
43 0.08
44 0.08
45 0.08
46 0.07
47 0.09
48 0.1
49 0.1
50 0.1
51 0.12
52 0.12
53 0.11
54 0.12
55 0.13
56 0.2
57 0.21
58 0.21
59 0.2
60 0.21
61 0.21
62 0.21
63 0.19
64 0.11
65 0.1
66 0.09
67 0.08
68 0.08
69 0.08
70 0.06
71 0.05
72 0.04
73 0.04
74 0.04
75 0.04
76 0.04
77 0.04
78 0.04
79 0.04
80 0.05
81 0.05
82 0.05
83 0.05
84 0.05
85 0.05
86 0.04
87 0.05
88 0.04
89 0.04
90 0.04
91 0.04
92 0.04
93 0.04
94 0.04
95 0.04
96 0.04
97 0.04
98 0.04
99 0.04
100 0.04
101 0.05
102 0.05
103 0.07
104 0.09
105 0.1
106 0.11
107 0.12
108 0.12
109 0.13
110 0.13
111 0.12
112 0.11
113 0.12
114 0.12
115 0.11
116 0.11
117 0.1
118 0.09
119 0.09
120 0.08
121 0.06
122 0.05
123 0.06
124 0.06
125 0.06
126 0.07
127 0.09
128 0.09
129 0.09
130 0.15
131 0.17
132 0.22
133 0.29
134 0.35
135 0.42
136 0.52
137 0.62
138 0.67
139 0.73
140 0.76
141 0.77
142 0.8
143 0.81
144 0.82
145 0.81
146 0.76
147 0.71
148 0.67
149 0.61
150 0.55
151 0.49
152 0.43