Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A559MG13

Protein Details
Accession A0A559MG13    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
30-56SSPPSTPPPVRNRGRRNKDRNGKSGEEHydrophilic
NLS Segment(s)
PositionSequence
42-47RGRRNK
Subcellular Location(s) nucl 20, cyto_nucl 14, cyto 6
Family & Domain DBs
Amino Acid Sequences MPDDFQSTNFAAASDDDENSLPAHSFSIQSSPPSTPPPVRNRGRRNKDRNGKSGEEGADLLLYLATSPSPANPTSRARMQPPSTPPPKSHALPSSMMTTPVGGSGLLSVFGGPNTPSQAFDFSDFVNITPSPAQRVWNKTPRIKTPLTVARRRLTFENSSPDLRESNSSAPKHTGLGMQLGGDLLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.14
4 0.14
5 0.14
6 0.14
7 0.14
8 0.1
9 0.08
10 0.1
11 0.09
12 0.1
13 0.11
14 0.15
15 0.15
16 0.17
17 0.2
18 0.2
19 0.22
20 0.25
21 0.28
22 0.31
23 0.38
24 0.44
25 0.51
26 0.58
27 0.66
28 0.73
29 0.79
30 0.84
31 0.86
32 0.87
33 0.88
34 0.9
35 0.88
36 0.86
37 0.82
38 0.74
39 0.66
40 0.61
41 0.51
42 0.42
43 0.34
44 0.25
45 0.18
46 0.14
47 0.12
48 0.06
49 0.05
50 0.03
51 0.03
52 0.03
53 0.04
54 0.04
55 0.04
56 0.07
57 0.08
58 0.1
59 0.14
60 0.18
61 0.21
62 0.27
63 0.28
64 0.3
65 0.36
66 0.37
67 0.39
68 0.42
69 0.46
70 0.46
71 0.46
72 0.43
73 0.41
74 0.42
75 0.37
76 0.35
77 0.3
78 0.28
79 0.27
80 0.27
81 0.26
82 0.22
83 0.21
84 0.17
85 0.14
86 0.11
87 0.09
88 0.08
89 0.04
90 0.04
91 0.04
92 0.04
93 0.04
94 0.04
95 0.04
96 0.03
97 0.03
98 0.04
99 0.04
100 0.05
101 0.08
102 0.08
103 0.09
104 0.1
105 0.13
106 0.13
107 0.15
108 0.15
109 0.12
110 0.15
111 0.14
112 0.13
113 0.13
114 0.12
115 0.12
116 0.13
117 0.14
118 0.15
119 0.16
120 0.21
121 0.24
122 0.32
123 0.39
124 0.46
125 0.53
126 0.56
127 0.61
128 0.65
129 0.66
130 0.6
131 0.53
132 0.54
133 0.56
134 0.57
135 0.58
136 0.57
137 0.56
138 0.56
139 0.58
140 0.53
141 0.5
142 0.47
143 0.45
144 0.47
145 0.44
146 0.45
147 0.43
148 0.41
149 0.36
150 0.31
151 0.3
152 0.25
153 0.3
154 0.36
155 0.35
156 0.36
157 0.39
158 0.38
159 0.36
160 0.33
161 0.28
162 0.22
163 0.24
164 0.22
165 0.18
166 0.17