Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A559MES9

Protein Details
Accession A0A559MES9   
Localization Confidence Medium
Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
24-43KSSTAPTKKVRKARAGRKTAHydrophilic
NLS Segment(s)
PositionSequence
31-42KKVRKARAGRKT
Subcellular Location(s) cyto 9.5, cyto_nucl 13.5, nucl 14.5
Family & Domain DBs
Amino Acid Sequences MRDENEEHNFQLFRECLSTPLIEKSSTAPTKKVRKARAGRKTAIKPVASAATEEADDAAELADFVDVSSKFLYRGFRILIKGILVSGYGNLHKSASRGPDTHVLNMAQYTFSTKPI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.2
3 0.18
4 0.2
5 0.21
6 0.17
7 0.21
8 0.21
9 0.19
10 0.19
11 0.2
12 0.27
13 0.31
14 0.31
15 0.32
16 0.39
17 0.49
18 0.56
19 0.62
20 0.6
21 0.65
22 0.73
23 0.79
24 0.8
25 0.78
26 0.75
27 0.76
28 0.74
29 0.71
30 0.67
31 0.56
32 0.46
33 0.41
34 0.38
35 0.29
36 0.24
37 0.17
38 0.12
39 0.11
40 0.1
41 0.08
42 0.05
43 0.05
44 0.04
45 0.03
46 0.02
47 0.02
48 0.03
49 0.02
50 0.02
51 0.02
52 0.05
53 0.05
54 0.07
55 0.07
56 0.08
57 0.08
58 0.11
59 0.14
60 0.12
61 0.15
62 0.16
63 0.18
64 0.2
65 0.21
66 0.19
67 0.17
68 0.16
69 0.13
70 0.11
71 0.08
72 0.07
73 0.07
74 0.08
75 0.08
76 0.09
77 0.1
78 0.1
79 0.11
80 0.12
81 0.16
82 0.2
83 0.24
84 0.24
85 0.27
86 0.35
87 0.37
88 0.38
89 0.37
90 0.31
91 0.27
92 0.27
93 0.24
94 0.17
95 0.14
96 0.18