Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A559MAQ2

Protein Details
Accession A0A559MAQ2   
Localization Confidence Low
Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MVSAKKHVPIVKKRTKRFHRHQSDTYMCLHydrophilic
NLS Segment(s)
PositionSequence
12-16KKRTK
Subcellular Location(s) cyto_nucl 4.333, mito 19.5, mito_nucl 12.833, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MVSAKKHVPIVKKRTKRFHRHQSDTYMCLDASWRKPKGIDNRVRRRFAGQMVMPSIGFGSNKKTRHMMPSGHKAFLVNNTRDVELLLMHNKTFAAEISHAVSSRKRIDIIQRAKELGVKVTNPKARVTTEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.88
3 0.9
4 0.9
5 0.91
6 0.91
7 0.9
8 0.86
9 0.85
10 0.8
11 0.71
12 0.63
13 0.53
14 0.42
15 0.33
16 0.3
17 0.26
18 0.28
19 0.34
20 0.33
21 0.32
22 0.35
23 0.42
24 0.5
25 0.54
26 0.56
27 0.58
28 0.68
29 0.75
30 0.77
31 0.7
32 0.63
33 0.57
34 0.5
35 0.46
36 0.36
37 0.31
38 0.3
39 0.29
40 0.25
41 0.21
42 0.18
43 0.11
44 0.1
45 0.07
46 0.12
47 0.17
48 0.19
49 0.21
50 0.23
51 0.24
52 0.29
53 0.32
54 0.32
55 0.33
56 0.42
57 0.43
58 0.41
59 0.4
60 0.35
61 0.31
62 0.33
63 0.34
64 0.24
65 0.25
66 0.26
67 0.26
68 0.26
69 0.25
70 0.18
71 0.11
72 0.13
73 0.12
74 0.11
75 0.11
76 0.11
77 0.11
78 0.11
79 0.1
80 0.09
81 0.09
82 0.09
83 0.11
84 0.13
85 0.14
86 0.14
87 0.15
88 0.17
89 0.19
90 0.22
91 0.23
92 0.22
93 0.24
94 0.34
95 0.43
96 0.5
97 0.53
98 0.52
99 0.52
100 0.51
101 0.51
102 0.43
103 0.38
104 0.33
105 0.28
106 0.32
107 0.39
108 0.44
109 0.42
110 0.44
111 0.42