Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A559M8P5

Protein Details
Accession A0A559M8P5   
Localization Confidence Medium
Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
29-56TTASIRARVKMKKRNRRRKSASTNDGESHydrophilic
NLS Segment(s)
PositionSequence
34-47RARVKMKKRNRRRK
Subcellular Location(s) cyto_nucl 10.5, mito 7, nucl 17.5
Family & Domain DBs
Amino Acid Sequences TPSTFRLTSNPPLWSRWSPPHGLTKWGGTTASIRARVKMKKRNRRRKSASTNDGESGPDLDSELDRDSGYNSRSDSEADSDAEAMYYQQKEDELEAEGVTLSNPCDDTQAMMEAELERWELYCKTTKKGHPETVIKECTSYEDPKEQEKHLAKHFKGYLFWRVKNSRIKKESLIITY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.49
3 0.49
4 0.5
5 0.47
6 0.49
7 0.56
8 0.51
9 0.51
10 0.46
11 0.42
12 0.39
13 0.36
14 0.32
15 0.23
16 0.23
17 0.25
18 0.28
19 0.3
20 0.29
21 0.32
22 0.39
23 0.46
24 0.54
25 0.57
26 0.63
27 0.67
28 0.78
29 0.85
30 0.88
31 0.91
32 0.91
33 0.92
34 0.92
35 0.91
36 0.89
37 0.84
38 0.78
39 0.68
40 0.59
41 0.48
42 0.38
43 0.28
44 0.19
45 0.12
46 0.09
47 0.08
48 0.07
49 0.08
50 0.08
51 0.08
52 0.07
53 0.07
54 0.09
55 0.11
56 0.12
57 0.12
58 0.12
59 0.12
60 0.13
61 0.13
62 0.13
63 0.12
64 0.13
65 0.12
66 0.11
67 0.11
68 0.1
69 0.09
70 0.08
71 0.06
72 0.07
73 0.06
74 0.06
75 0.06
76 0.06
77 0.07
78 0.07
79 0.08
80 0.07
81 0.07
82 0.07
83 0.07
84 0.07
85 0.06
86 0.06
87 0.05
88 0.04
89 0.04
90 0.05
91 0.05
92 0.06
93 0.06
94 0.07
95 0.07
96 0.09
97 0.09
98 0.08
99 0.09
100 0.08
101 0.08
102 0.08
103 0.07
104 0.05
105 0.06
106 0.08
107 0.08
108 0.1
109 0.17
110 0.19
111 0.23
112 0.31
113 0.36
114 0.44
115 0.52
116 0.57
117 0.58
118 0.63
119 0.65
120 0.65
121 0.64
122 0.54
123 0.47
124 0.39
125 0.36
126 0.34
127 0.31
128 0.26
129 0.29
130 0.31
131 0.38
132 0.42
133 0.38
134 0.43
135 0.47
136 0.49
137 0.52
138 0.59
139 0.52
140 0.58
141 0.61
142 0.54
143 0.52
144 0.51
145 0.52
146 0.5
147 0.53
148 0.54
149 0.54
150 0.59
151 0.64
152 0.69
153 0.7
154 0.67
155 0.68
156 0.64
157 0.67