Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A559M0Y9

Protein Details
Accession A0A559M0Y9   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
68-87RYTIRTWRIYPKKKAKEGGPHydrophilic
NLS Segment(s)
PositionSequence
80-81KK
Subcellular Location(s) cyto 12, cyto_nucl 12, nucl 12
Family & Domain DBs
Amino Acid Sequences FDRYFGSPDNLENWQRLCHDVGVEDDLSSITKCREALKGIWINIYDFLDAVKKDEQPRRFPSQRALARYTIRTWRIYPKKKAKEGGPVRALLAHIF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.26
3 0.26
4 0.25
5 0.21
6 0.19
7 0.18
8 0.18
9 0.18
10 0.17
11 0.14
12 0.12
13 0.11
14 0.11
15 0.1
16 0.09
17 0.07
18 0.08
19 0.09
20 0.11
21 0.13
22 0.15
23 0.16
24 0.24
25 0.28
26 0.27
27 0.28
28 0.26
29 0.24
30 0.23
31 0.22
32 0.13
33 0.08
34 0.08
35 0.08
36 0.08
37 0.09
38 0.1
39 0.12
40 0.19
41 0.26
42 0.31
43 0.36
44 0.42
45 0.5
46 0.52
47 0.51
48 0.52
49 0.55
50 0.56
51 0.55
52 0.53
53 0.48
54 0.48
55 0.49
56 0.46
57 0.43
58 0.41
59 0.38
60 0.37
61 0.43
62 0.51
63 0.58
64 0.64
65 0.68
66 0.75
67 0.79
68 0.83
69 0.78
70 0.79
71 0.78
72 0.78
73 0.72
74 0.62
75 0.55
76 0.5