Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A559M7N6

Protein Details
Accession A0A559M7N6   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
306-331AGPTDKREIAKRKGEKEKEKGCKVVWBasic
NLS Segment(s)
PositionSequence
140-173PPHRPPPHLPINRRNRLHGKKLPLPIGALPRPRN
313-325EIAKRKGEKEKEK
Subcellular Location(s) extr 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR013320  ConA-like_dom_sf  
IPR000757  GH16  
Gene Ontology GO:0004553  F:hydrolase activity, hydrolyzing O-glycosyl compounds  
GO:0005975  P:carbohydrate metabolic process  
Pfam View protein in Pfam  
PF00722  Glyco_hydro_16  
CDD cd00413  Glyco_hydrolase_16  
Amino Acid Sequences MFAPSTTWPPSRIIAIILLSSISSLTSAQTDNGNECSCFQTNGSSAGYFTSHRFLDYRNVPSVSPEVPALLPNITNATNAFATSEFFTNDAWRNDWAIQNWNNSDDVASGDSPTLRVNSPNNIYIEKQRHRPLLHNLPHPPHRPPPHLPINRRNRLHGKKLPLPIGALPRPRNRLPGRCAGIFTYRHAAASPSSVQEADIEILTRGARNAVQYTNQPSQDAPEATRNVTVPQGRDWTAWNTYRVDWMPGMSSWYVDGVGVAEIGFQAPRDPAGLCVNMWSDGGGVDGEYEYIQWVEVVFNTSGPYAGPTDKREIAKRKGEKEKEKGCKVVWWGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.21
3 0.19
4 0.16
5 0.14
6 0.11
7 0.11
8 0.09
9 0.06
10 0.05
11 0.05
12 0.06
13 0.08
14 0.09
15 0.1
16 0.14
17 0.15
18 0.17
19 0.21
20 0.21
21 0.2
22 0.21
23 0.25
24 0.22
25 0.22
26 0.2
27 0.21
28 0.21
29 0.24
30 0.24
31 0.19
32 0.18
33 0.18
34 0.19
35 0.16
36 0.16
37 0.17
38 0.16
39 0.17
40 0.18
41 0.18
42 0.26
43 0.31
44 0.35
45 0.35
46 0.37
47 0.35
48 0.37
49 0.38
50 0.29
51 0.24
52 0.19
53 0.15
54 0.14
55 0.15
56 0.14
57 0.11
58 0.11
59 0.1
60 0.12
61 0.11
62 0.11
63 0.11
64 0.12
65 0.11
66 0.11
67 0.12
68 0.09
69 0.1
70 0.11
71 0.12
72 0.1
73 0.1
74 0.11
75 0.13
76 0.18
77 0.19
78 0.19
79 0.19
80 0.2
81 0.22
82 0.25
83 0.23
84 0.25
85 0.27
86 0.3
87 0.3
88 0.29
89 0.27
90 0.24
91 0.23
92 0.16
93 0.13
94 0.1
95 0.09
96 0.08
97 0.08
98 0.08
99 0.09
100 0.09
101 0.09
102 0.08
103 0.11
104 0.13
105 0.18
106 0.21
107 0.24
108 0.25
109 0.25
110 0.26
111 0.3
112 0.37
113 0.36
114 0.4
115 0.42
116 0.46
117 0.46
118 0.51
119 0.52
120 0.54
121 0.57
122 0.56
123 0.56
124 0.55
125 0.6
126 0.57
127 0.52
128 0.5
129 0.49
130 0.48
131 0.48
132 0.51
133 0.55
134 0.6
135 0.63
136 0.64
137 0.69
138 0.72
139 0.69
140 0.66
141 0.66
142 0.65
143 0.67
144 0.63
145 0.6
146 0.58
147 0.61
148 0.58
149 0.49
150 0.43
151 0.36
152 0.36
153 0.32
154 0.31
155 0.31
156 0.33
157 0.37
158 0.37
159 0.43
160 0.42
161 0.46
162 0.45
163 0.49
164 0.48
165 0.43
166 0.43
167 0.37
168 0.37
169 0.31
170 0.28
171 0.23
172 0.2
173 0.19
174 0.18
175 0.17
176 0.12
177 0.14
178 0.14
179 0.1
180 0.11
181 0.11
182 0.1
183 0.1
184 0.1
185 0.08
186 0.07
187 0.06
188 0.06
189 0.06
190 0.06
191 0.06
192 0.05
193 0.06
194 0.07
195 0.08
196 0.1
197 0.11
198 0.13
199 0.16
200 0.22
201 0.26
202 0.26
203 0.25
204 0.23
205 0.24
206 0.26
207 0.24
208 0.2
209 0.21
210 0.22
211 0.23
212 0.24
213 0.22
214 0.19
215 0.22
216 0.22
217 0.18
218 0.19
219 0.22
220 0.22
221 0.23
222 0.24
223 0.24
224 0.27
225 0.28
226 0.28
227 0.26
228 0.25
229 0.3
230 0.28
231 0.26
232 0.21
233 0.19
234 0.18
235 0.16
236 0.19
237 0.14
238 0.13
239 0.11
240 0.11
241 0.1
242 0.08
243 0.08
244 0.05
245 0.05
246 0.05
247 0.05
248 0.04
249 0.04
250 0.05
251 0.05
252 0.04
253 0.05
254 0.05
255 0.06
256 0.07
257 0.08
258 0.1
259 0.14
260 0.15
261 0.14
262 0.16
263 0.17
264 0.16
265 0.16
266 0.13
267 0.09
268 0.08
269 0.09
270 0.07
271 0.05
272 0.05
273 0.05
274 0.05
275 0.05
276 0.05
277 0.05
278 0.05
279 0.06
280 0.05
281 0.05
282 0.06
283 0.07
284 0.1
285 0.1
286 0.1
287 0.11
288 0.11
289 0.11
290 0.1
291 0.12
292 0.11
293 0.16
294 0.2
295 0.23
296 0.3
297 0.36
298 0.41
299 0.48
300 0.54
301 0.58
302 0.64
303 0.69
304 0.73
305 0.78
306 0.83
307 0.85
308 0.86
309 0.88
310 0.88
311 0.86
312 0.82
313 0.73
314 0.69