Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A559M0N6

Protein Details
Accession A0A559M0N6   
Localization Confidence Medium
Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
23-50LSSLSLSTKKSRKQRKKSPTPPTQNDDQHydrophilic
NLS Segment(s)
PositionSequence
31-39KKSRKQRKK
Subcellular Location(s) cyto 5, cyto_mito 5.333, cyto_nucl 9.333, extr 3, mito 4.5, nucl 12.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001328  Pept_tRNA_hydro  
IPR036416  Pept_tRNA_hydro_sf  
Gene Ontology GO:0004045  F:aminoacyl-tRNA hydrolase activity  
Pfam View protein in Pfam  
PF01195  Pept_tRNA_hydro  
Amino Acid Sequences MSIAKDHQKMAQPTEEIPLSTNLSSLSLSTKKSRKQRKKSPTPPTQNDDQVAITSIPNSLPEMATPLRLLVCSIGNPAPYTNTFHSAGHNVLTSLAASLSYPPFQKSRDHGNGLVSQGPEYTLWQSRSLMNVSGAGVSGAWRAFQKHHGSGNGGEQIGLVVVHDELELGIGEVRVRDGGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.37
3 0.29
4 0.27
5 0.25
6 0.22
7 0.2
8 0.19
9 0.14
10 0.14
11 0.14
12 0.13
13 0.16
14 0.16
15 0.19
16 0.26
17 0.33
18 0.4
19 0.5
20 0.61
21 0.66
22 0.74
23 0.83
24 0.86
25 0.91
26 0.93
27 0.94
28 0.94
29 0.93
30 0.9
31 0.84
32 0.79
33 0.72
34 0.63
35 0.54
36 0.43
37 0.32
38 0.26
39 0.21
40 0.15
41 0.11
42 0.1
43 0.08
44 0.08
45 0.08
46 0.07
47 0.07
48 0.07
49 0.11
50 0.11
51 0.11
52 0.11
53 0.1
54 0.1
55 0.1
56 0.1
57 0.07
58 0.07
59 0.07
60 0.09
61 0.09
62 0.09
63 0.1
64 0.1
65 0.1
66 0.11
67 0.15
68 0.14
69 0.16
70 0.17
71 0.17
72 0.18
73 0.18
74 0.18
75 0.14
76 0.13
77 0.09
78 0.08
79 0.08
80 0.06
81 0.05
82 0.04
83 0.04
84 0.04
85 0.05
86 0.05
87 0.07
88 0.08
89 0.09
90 0.11
91 0.12
92 0.16
93 0.18
94 0.27
95 0.32
96 0.35
97 0.35
98 0.36
99 0.37
100 0.35
101 0.35
102 0.25
103 0.19
104 0.15
105 0.14
106 0.12
107 0.1
108 0.12
109 0.14
110 0.16
111 0.17
112 0.18
113 0.19
114 0.21
115 0.21
116 0.2
117 0.16
118 0.15
119 0.14
120 0.13
121 0.12
122 0.09
123 0.07
124 0.06
125 0.07
126 0.06
127 0.06
128 0.07
129 0.09
130 0.11
131 0.19
132 0.25
133 0.29
134 0.34
135 0.35
136 0.38
137 0.38
138 0.41
139 0.38
140 0.31
141 0.26
142 0.21
143 0.18
144 0.16
145 0.13
146 0.08
147 0.04
148 0.04
149 0.05
150 0.04
151 0.04
152 0.04
153 0.05
154 0.05
155 0.05
156 0.06
157 0.06
158 0.06
159 0.07
160 0.08