Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A559MGI2

Protein Details
Accession A0A559MGI2   
Localization Confidence Medium
Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
5-32QPELKKVRKAPFHPYNRRQNRGNRSMRQHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 12, mito 3, nucl 21.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR044641  Lsm7/SmG-like  
IPR010920  LSM_dom_sf  
IPR047575  Sm  
IPR001163  Sm_dom_euk/arc  
IPR034098  Sm_G  
Gene Ontology GO:0005681  C:spliceosomal complex  
GO:0003723  F:RNA binding  
GO:0000387  P:spliceosomal snRNP assembly  
Pfam View protein in Pfam  
PF01423  LSM  
PROSITE View protein in PROSITE  
PS52002  SM  
CDD cd01719  Sm_G  
Amino Acid Sequences MPQAQPELKKVRKAPFHPYNRRQNRGNRSMRQQPSLEDRDGKSKQKEKWTDPRLQYLDKRLFVQLNGSRKVIGVLRGYDVFLNIVLDDAVEEKDGGEKVRLGMVVIRGNSVVMLEALERIGGGREDRG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.71
3 0.76
4 0.8
5 0.82
6 0.84
7 0.85
8 0.86
9 0.83
10 0.82
11 0.82
12 0.81
13 0.82
14 0.77
15 0.75
16 0.79
17 0.76
18 0.71
19 0.62
20 0.55
21 0.54
22 0.51
23 0.46
24 0.39
25 0.36
26 0.39
27 0.42
28 0.45
29 0.44
30 0.47
31 0.5
32 0.56
33 0.62
34 0.61
35 0.68
36 0.67
37 0.68
38 0.64
39 0.67
40 0.6
41 0.57
42 0.52
43 0.5
44 0.49
45 0.41
46 0.4
47 0.33
48 0.31
49 0.26
50 0.3
51 0.26
52 0.26
53 0.27
54 0.26
55 0.24
56 0.23
57 0.25
58 0.19
59 0.18
60 0.14
61 0.13
62 0.14
63 0.14
64 0.15
65 0.13
66 0.12
67 0.09
68 0.07
69 0.07
70 0.05
71 0.05
72 0.04
73 0.04
74 0.04
75 0.04
76 0.04
77 0.05
78 0.05
79 0.05
80 0.07
81 0.08
82 0.09
83 0.09
84 0.09
85 0.1
86 0.12
87 0.12
88 0.1
89 0.12
90 0.15
91 0.18
92 0.18
93 0.18
94 0.16
95 0.16
96 0.15
97 0.13
98 0.09
99 0.05
100 0.06
101 0.05
102 0.06
103 0.06
104 0.06
105 0.05
106 0.05
107 0.07
108 0.08