Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A559MB29

Protein Details
Accession A0A559MB29    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MYKQQRKKRNTQEKFRRRKISLVSHydrophilic
NLS Segment(s)
PositionSequence
6-19RKKRNTQEKFRRRK
Subcellular Location(s) mito 13, nucl 10, cyto 4
Family & Domain DBs
Amino Acid Sequences MYKQQRKKRNTQEKFRRRKISLVSKVDDLHRFFGADAFLVIRMRGRYYAYISTEGPYWPPTKEQMEQSYPLPEMKTPRDFDVVKEI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.95
2 0.94
3 0.92
4 0.83
5 0.81
6 0.79
7 0.79
8 0.78
9 0.74
10 0.67
11 0.6
12 0.59
13 0.55
14 0.5
15 0.4
16 0.32
17 0.26
18 0.23
19 0.2
20 0.19
21 0.15
22 0.1
23 0.08
24 0.06
25 0.07
26 0.06
27 0.06
28 0.06
29 0.07
30 0.07
31 0.08
32 0.09
33 0.1
34 0.13
35 0.16
36 0.17
37 0.19
38 0.19
39 0.19
40 0.18
41 0.17
42 0.15
43 0.14
44 0.13
45 0.12
46 0.13
47 0.17
48 0.21
49 0.24
50 0.29
51 0.33
52 0.36
53 0.38
54 0.37
55 0.36
56 0.33
57 0.31
58 0.26
59 0.22
60 0.25
61 0.29
62 0.35
63 0.34
64 0.37
65 0.42
66 0.41