Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A559MLQ0

Protein Details
Accession A0A559MLQ0    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-31MPKEKSTKRAPVKRAEKKKKDPNAPKRGLSABasic
NLS Segment(s)
PositionSequence
4-27EKSTKRAPVKRAEKKKKDPNAPKR
Subcellular Location(s) nucl 21, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MPKEKSTKRAPVKRAEKKKKDPNAPKRGLSAYMFFANEQRENVRDENPGITFGQVGKVLGERWKALNDKQRTPYEAKAAQDKKRYEDEKATYNVSAEKPVGVRKRTGQGTNKNVAQADAEEEEST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.89
3 0.89
4 0.9
5 0.94
6 0.93
7 0.93
8 0.93
9 0.93
10 0.93
11 0.88
12 0.8
13 0.74
14 0.67
15 0.59
16 0.5
17 0.41
18 0.33
19 0.29
20 0.26
21 0.22
22 0.22
23 0.21
24 0.2
25 0.19
26 0.17
27 0.16
28 0.19
29 0.21
30 0.2
31 0.19
32 0.19
33 0.19
34 0.18
35 0.18
36 0.15
37 0.13
38 0.11
39 0.1
40 0.1
41 0.08
42 0.08
43 0.07
44 0.07
45 0.08
46 0.1
47 0.11
48 0.1
49 0.1
50 0.13
51 0.15
52 0.19
53 0.27
54 0.3
55 0.34
56 0.4
57 0.41
58 0.42
59 0.44
60 0.43
61 0.41
62 0.39
63 0.35
64 0.38
65 0.43
66 0.45
67 0.49
68 0.48
69 0.45
70 0.5
71 0.51
72 0.46
73 0.48
74 0.45
75 0.43
76 0.44
77 0.42
78 0.34
79 0.32
80 0.32
81 0.24
82 0.23
83 0.18
84 0.17
85 0.16
86 0.23
87 0.3
88 0.28
89 0.31
90 0.34
91 0.42
92 0.46
93 0.53
94 0.55
95 0.58
96 0.64
97 0.68
98 0.65
99 0.6
100 0.54
101 0.46
102 0.38
103 0.29
104 0.25
105 0.2