Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A559M2F2

Protein Details
Accession A0A559M2F2    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
147-171GEKKKAGPGRPKNSSGPKKEKKAPTBasic
NLS Segment(s)
PositionSequence
147-171GEKKKAGPGRPKNSSGPKKEKKAPT
Subcellular Location(s) nucl 12.5, cyto_nucl 10, mito 7, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR021331  Hva1_TUDOR  
Pfam View protein in Pfam  
PF11160  Hva1_TUDOR  
Amino Acid Sequences MSTQIQEGDKVSWNWNGSHPSGTASEVKPGEVTVTSHRGNDISKTGDESNPAVHISRSGNDVVKTANELKVESKGESNGPSTEESNGNGAPAKSEEKKEPEEAHTGEKRTVDEKPSADDAEEKPEDPDADAKKQKTGTDAKTNGTNGEKKKAGPGRPKNSSGPKKEKKAPT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.31
3 0.33
4 0.3
5 0.3
6 0.27
7 0.25
8 0.24
9 0.25
10 0.26
11 0.22
12 0.26
13 0.24
14 0.24
15 0.22
16 0.21
17 0.19
18 0.15
19 0.17
20 0.15
21 0.21
22 0.21
23 0.21
24 0.22
25 0.22
26 0.22
27 0.22
28 0.2
29 0.18
30 0.17
31 0.21
32 0.22
33 0.22
34 0.23
35 0.21
36 0.18
37 0.16
38 0.16
39 0.13
40 0.11
41 0.13
42 0.12
43 0.12
44 0.13
45 0.14
46 0.15
47 0.15
48 0.16
49 0.14
50 0.13
51 0.14
52 0.14
53 0.15
54 0.13
55 0.14
56 0.14
57 0.17
58 0.18
59 0.16
60 0.15
61 0.14
62 0.15
63 0.15
64 0.16
65 0.13
66 0.13
67 0.13
68 0.13
69 0.14
70 0.13
71 0.12
72 0.12
73 0.11
74 0.1
75 0.1
76 0.09
77 0.08
78 0.09
79 0.12
80 0.12
81 0.15
82 0.18
83 0.21
84 0.24
85 0.27
86 0.28
87 0.28
88 0.3
89 0.3
90 0.33
91 0.32
92 0.31
93 0.29
94 0.27
95 0.26
96 0.23
97 0.24
98 0.21
99 0.22
100 0.21
101 0.23
102 0.24
103 0.23
104 0.22
105 0.23
106 0.21
107 0.24
108 0.24
109 0.2
110 0.18
111 0.19
112 0.19
113 0.17
114 0.22
115 0.19
116 0.26
117 0.32
118 0.32
119 0.36
120 0.38
121 0.38
122 0.39
123 0.43
124 0.42
125 0.46
126 0.48
127 0.46
128 0.49
129 0.49
130 0.46
131 0.44
132 0.43
133 0.36
134 0.41
135 0.41
136 0.36
137 0.45
138 0.49
139 0.53
140 0.57
141 0.64
142 0.67
143 0.72
144 0.77
145 0.76
146 0.79
147 0.8
148 0.8
149 0.8
150 0.8
151 0.82