Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A559MA28

Protein Details
Accession A0A559MA28   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MASILKKIFHRKKNVPLACVHydrophilic
184-205EVVKVKKGPNKGKKIAHRNLVKBasic
NLS Segment(s)
PositionSequence
188-199VKKGPNKGKKIA
Subcellular Location(s) cyto 22, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR010634  DUF1223  
IPR036249  Thioredoxin-like_sf  
Pfam View protein in Pfam  
PF06764  DUF1223  
Amino Acid Sequences MASILKKIFHRKKNVPLACVMSLENEPEHVHTGACFLDIQPLSIVELFQSQGCASCPPTTPKVLEATMNPNLLLLSYDVTYFNHAGWVDTFANGKWDNRQRAYLKKWGRSTIYTPNVVADGVADGTGAGDNEVHDIVDKARVMRHQLPWHVIVDTNDTELRIDSDGTDVGMFDVCLVNYDPKFEVVKVKKGPNKGKKIAHRNLVKDIVKIGEWNGGNVTISMPDMSRMEGTGLETVAIVQGAMGGPIVAAQKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.74
3 0.7
4 0.67
5 0.58
6 0.51
7 0.4
8 0.32
9 0.27
10 0.26
11 0.2
12 0.16
13 0.15
14 0.15
15 0.18
16 0.15
17 0.15
18 0.13
19 0.14
20 0.13
21 0.12
22 0.11
23 0.08
24 0.15
25 0.15
26 0.16
27 0.15
28 0.15
29 0.16
30 0.15
31 0.15
32 0.08
33 0.09
34 0.09
35 0.08
36 0.09
37 0.08
38 0.08
39 0.1
40 0.11
41 0.12
42 0.14
43 0.17
44 0.21
45 0.25
46 0.27
47 0.27
48 0.28
49 0.29
50 0.28
51 0.26
52 0.24
53 0.27
54 0.28
55 0.27
56 0.24
57 0.2
58 0.19
59 0.17
60 0.15
61 0.09
62 0.06
63 0.06
64 0.07
65 0.07
66 0.08
67 0.1
68 0.1
69 0.09
70 0.11
71 0.11
72 0.11
73 0.11
74 0.15
75 0.13
76 0.13
77 0.14
78 0.11
79 0.15
80 0.15
81 0.15
82 0.19
83 0.26
84 0.31
85 0.32
86 0.39
87 0.39
88 0.46
89 0.51
90 0.52
91 0.52
92 0.53
93 0.55
94 0.53
95 0.52
96 0.47
97 0.47
98 0.47
99 0.44
100 0.38
101 0.34
102 0.3
103 0.27
104 0.24
105 0.19
106 0.09
107 0.05
108 0.04
109 0.04
110 0.03
111 0.03
112 0.03
113 0.03
114 0.03
115 0.03
116 0.03
117 0.03
118 0.04
119 0.04
120 0.04
121 0.04
122 0.04
123 0.05
124 0.07
125 0.07
126 0.07
127 0.09
128 0.1
129 0.16
130 0.21
131 0.27
132 0.29
133 0.31
134 0.34
135 0.34
136 0.33
137 0.28
138 0.24
139 0.19
140 0.18
141 0.16
142 0.15
143 0.13
144 0.13
145 0.12
146 0.11
147 0.12
148 0.08
149 0.08
150 0.06
151 0.07
152 0.07
153 0.07
154 0.07
155 0.06
156 0.05
157 0.05
158 0.05
159 0.04
160 0.05
161 0.04
162 0.06
163 0.07
164 0.1
165 0.1
166 0.13
167 0.13
168 0.14
169 0.16
170 0.15
171 0.24
172 0.25
173 0.34
174 0.38
175 0.46
176 0.48
177 0.57
178 0.67
179 0.67
180 0.73
181 0.73
182 0.76
183 0.78
184 0.84
185 0.82
186 0.81
187 0.78
188 0.73
189 0.71
190 0.72
191 0.63
192 0.53
193 0.47
194 0.39
195 0.32
196 0.28
197 0.22
198 0.2
199 0.18
200 0.18
201 0.17
202 0.16
203 0.15
204 0.15
205 0.14
206 0.08
207 0.09
208 0.09
209 0.08
210 0.09
211 0.1
212 0.11
213 0.11
214 0.11
215 0.11
216 0.11
217 0.13
218 0.12
219 0.12
220 0.1
221 0.1
222 0.09
223 0.09
224 0.08
225 0.06
226 0.04
227 0.05
228 0.05
229 0.05
230 0.05
231 0.04
232 0.04
233 0.06