Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A559LYI9

Protein Details
Accession A0A559LYI9   
Localization Confidence Medium
Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
115-139LAETMHKKRVERLKRKEKRNKMLKSBasic
NLS Segment(s)
PositionSequence
66-139KRQEERKFMAAVKAKEKEMKDEKEAERQRRITALKEKRAVKEEKARYEKLAETMHKKRVERLKRKEKRNKMLKS
Subcellular Location(s) cyto 4.5, cyto_mito 6, mito 6.5, nucl 16
Family & Domain DBs
InterPro View protein in InterPro  
IPR005579  Cgr1-like  
Gene Ontology GO:0005730  C:nucleolus  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF03879  Cgr1  
Amino Acid Sequences MSTEVATTTAPIAVATVPAQGMRKNGLPYHPHPLSLHPQANDSPGKQWHEPKSAFRPKAGNGTYEKRQEERKFMAAVKAKEKEMKDEKEAERQRRITALKEKRAVKEEKARYEKLAETMHKKRVERLKRKEKRNKMLKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.08
4 0.07
5 0.09
6 0.11
7 0.12
8 0.14
9 0.15
10 0.19
11 0.21
12 0.24
13 0.28
14 0.33
15 0.36
16 0.43
17 0.41
18 0.39
19 0.37
20 0.39
21 0.4
22 0.41
23 0.42
24 0.33
25 0.35
26 0.33
27 0.37
28 0.34
29 0.28
30 0.24
31 0.24
32 0.28
33 0.29
34 0.36
35 0.37
36 0.43
37 0.44
38 0.46
39 0.52
40 0.57
41 0.55
42 0.5
43 0.47
44 0.42
45 0.48
46 0.43
47 0.36
48 0.31
49 0.35
50 0.37
51 0.39
52 0.39
53 0.32
54 0.39
55 0.38
56 0.39
57 0.38
58 0.35
59 0.32
60 0.31
61 0.36
62 0.34
63 0.34
64 0.34
65 0.33
66 0.31
67 0.34
68 0.34
69 0.35
70 0.37
71 0.38
72 0.36
73 0.41
74 0.42
75 0.48
76 0.55
77 0.53
78 0.53
79 0.51
80 0.49
81 0.47
82 0.47
83 0.44
84 0.48
85 0.51
86 0.51
87 0.57
88 0.6
89 0.59
90 0.64
91 0.61
92 0.58
93 0.59
94 0.59
95 0.62
96 0.64
97 0.61
98 0.57
99 0.57
100 0.51
101 0.47
102 0.46
103 0.41
104 0.43
105 0.48
106 0.54
107 0.56
108 0.55
109 0.58
110 0.62
111 0.67
112 0.69
113 0.73
114 0.77
115 0.8
116 0.9
117 0.93
118 0.94
119 0.93