Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A559MA20

Protein Details
Accession A0A559MA20    Localization Confidence High Confidence Score 15.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MSSEIARKRGRPKKVISDPVESHydrophilic
NLS Segment(s)
PositionSequence
7-14RKRGRPKK
49-49K
Subcellular Location(s) nucl 14, mito 10, cyto 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSSEIARKRGRPKKVISDPVESEIPETTKKSTTRAKSTKAAASKSSTPKAKTATPAKASVSKPAASSLPPQKATTSKAPSPPVKKPESQTPPPAPAPAKQPPKTPVTPETSKILSKVRELSQETIPKLEEAARSSKPSPTNLGSEPVSTPQTNTPPPNPTNISPPKPPPAPKATAPSATKPHVPLASLNSEIVSNISTRAGARPNTAGSRALPPNYKMAARKVTMAIVAAPILIVTSYVLYERLVLGEERKLLVKPLPPVESEQAVKIEAIQSE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.85
3 0.8
4 0.79
5 0.73
6 0.68
7 0.61
8 0.5
9 0.4
10 0.32
11 0.29
12 0.24
13 0.22
14 0.21
15 0.25
16 0.27
17 0.32
18 0.39
19 0.45
20 0.53
21 0.59
22 0.63
23 0.63
24 0.68
25 0.69
26 0.66
27 0.62
28 0.55
29 0.52
30 0.55
31 0.55
32 0.57
33 0.55
34 0.51
35 0.52
36 0.52
37 0.51
38 0.51
39 0.52
40 0.53
41 0.51
42 0.52
43 0.5
44 0.54
45 0.5
46 0.49
47 0.45
48 0.37
49 0.34
50 0.32
51 0.3
52 0.24
53 0.31
54 0.31
55 0.34
56 0.35
57 0.35
58 0.36
59 0.38
60 0.41
61 0.42
62 0.41
63 0.38
64 0.42
65 0.48
66 0.53
67 0.57
68 0.6
69 0.58
70 0.56
71 0.56
72 0.54
73 0.58
74 0.59
75 0.58
76 0.59
77 0.56
78 0.56
79 0.53
80 0.53
81 0.44
82 0.38
83 0.39
84 0.39
85 0.45
86 0.41
87 0.46
88 0.46
89 0.5
90 0.5
91 0.47
92 0.44
93 0.42
94 0.43
95 0.39
96 0.39
97 0.35
98 0.33
99 0.3
100 0.29
101 0.23
102 0.23
103 0.25
104 0.24
105 0.28
106 0.3
107 0.31
108 0.32
109 0.35
110 0.33
111 0.3
112 0.28
113 0.22
114 0.2
115 0.19
116 0.15
117 0.12
118 0.16
119 0.16
120 0.19
121 0.2
122 0.24
123 0.23
124 0.23
125 0.25
126 0.23
127 0.25
128 0.23
129 0.25
130 0.21
131 0.2
132 0.19
133 0.17
134 0.17
135 0.14
136 0.14
137 0.14
138 0.18
139 0.2
140 0.22
141 0.24
142 0.27
143 0.28
144 0.32
145 0.32
146 0.29
147 0.35
148 0.4
149 0.41
150 0.39
151 0.42
152 0.43
153 0.45
154 0.47
155 0.44
156 0.43
157 0.43
158 0.42
159 0.45
160 0.42
161 0.44
162 0.43
163 0.42
164 0.4
165 0.38
166 0.37
167 0.32
168 0.33
169 0.27
170 0.25
171 0.22
172 0.22
173 0.23
174 0.22
175 0.2
176 0.17
177 0.16
178 0.15
179 0.13
180 0.09
181 0.06
182 0.06
183 0.06
184 0.07
185 0.07
186 0.1
187 0.14
188 0.15
189 0.17
190 0.19
191 0.22
192 0.24
193 0.25
194 0.24
195 0.21
196 0.27
197 0.28
198 0.29
199 0.29
200 0.28
201 0.32
202 0.33
203 0.35
204 0.31
205 0.34
206 0.38
207 0.35
208 0.37
209 0.33
210 0.31
211 0.28
212 0.26
213 0.2
214 0.14
215 0.12
216 0.09
217 0.07
218 0.06
219 0.05
220 0.04
221 0.04
222 0.03
223 0.04
224 0.04
225 0.05
226 0.06
227 0.06
228 0.07
229 0.07
230 0.07
231 0.09
232 0.09
233 0.11
234 0.14
235 0.16
236 0.16
237 0.18
238 0.18
239 0.19
240 0.23
241 0.26
242 0.29
243 0.34
244 0.36
245 0.35
246 0.4
247 0.42
248 0.42
249 0.39
250 0.35
251 0.29
252 0.27
253 0.26
254 0.22