Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A559M5M3

Protein Details
Accession A0A559M5M3   
Localization Confidence Low
Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
36-66EKMSPKHQFRLERRFRRRSKLQWARPRWTKAHydrophilic
NLS Segment(s)
PositionSequence
44-62FRLERRFRRRSKLQWARPR
Subcellular Location(s) mito 2, mito_nucl 2, nucl 2, plas 21
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MFPTIIRRAAQKGAEEIPLIYTNPYKAKRLWPPDFEKMSPKHQFRLERRFRRRSKLQWARPRWTKAVKMVQFGSIVFVAVYGVLFLDWDGMGNPEHPPFQTIRTWFFGLTGNIWGRDQVRRRDAPDEASPVSSSDS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.3
3 0.26
4 0.23
5 0.21
6 0.19
7 0.16
8 0.15
9 0.16
10 0.23
11 0.26
12 0.26
13 0.28
14 0.36
15 0.44
16 0.53
17 0.57
18 0.58
19 0.62
20 0.68
21 0.7
22 0.63
23 0.61
24 0.54
25 0.56
26 0.57
27 0.52
28 0.48
29 0.5
30 0.58
31 0.58
32 0.66
33 0.67
34 0.7
35 0.77
36 0.82
37 0.81
38 0.81
39 0.82
40 0.79
41 0.8
42 0.8
43 0.81
44 0.81
45 0.83
46 0.82
47 0.8
48 0.76
49 0.7
50 0.64
51 0.58
52 0.54
53 0.56
54 0.5
55 0.45
56 0.41
57 0.37
58 0.32
59 0.29
60 0.23
61 0.13
62 0.11
63 0.07
64 0.06
65 0.05
66 0.04
67 0.04
68 0.02
69 0.02
70 0.02
71 0.02
72 0.02
73 0.03
74 0.03
75 0.03
76 0.03
77 0.04
78 0.05
79 0.06
80 0.07
81 0.08
82 0.09
83 0.09
84 0.11
85 0.11
86 0.14
87 0.19
88 0.2
89 0.23
90 0.27
91 0.28
92 0.26
93 0.26
94 0.27
95 0.23
96 0.21
97 0.22
98 0.2
99 0.2
100 0.2
101 0.21
102 0.19
103 0.27
104 0.32
105 0.36
106 0.43
107 0.47
108 0.51
109 0.54
110 0.55
111 0.53
112 0.52
113 0.49
114 0.43
115 0.4
116 0.36