Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A559M294

Protein Details
Accession A0A559M294    Localization Confidence Low Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
152-176LDGKGRKRGVTREKRRDHPDKSLKDBasic
NLS Segment(s)
PositionSequence
155-168KGRKRGVTREKRRD
Subcellular Location(s) plas 18, mito 3, nucl 2.5, cyto_nucl 2.5, E.R. 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR013717  PIG-P  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF08510  PIG-P  
Amino Acid Sequences SSPSPPPPQHNFFAPPFYNRPPTPLPPSPSLTSLLRPSRPTTPDSSADELEPVPRASPKVPTYEYYGFVLYLFSSLTFLIYLLWSYLPSPFLHALGIYYYPNRWWSLALPSFIVMLLVYIYVALASYNTGYLTLPLSSIETIIDDAANVATLDGKGRKRGVTREKRRDHPDKSLKDWQSLWSRGTDAVMDVPLGGVCEVLYGDLRVDMEIEEEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.46
3 0.47
4 0.49
5 0.51
6 0.45
7 0.49
8 0.47
9 0.51
10 0.54
11 0.55
12 0.55
13 0.52
14 0.57
15 0.53
16 0.48
17 0.45
18 0.38
19 0.35
20 0.38
21 0.39
22 0.38
23 0.38
24 0.4
25 0.44
26 0.44
27 0.44
28 0.42
29 0.41
30 0.42
31 0.44
32 0.44
33 0.38
34 0.35
35 0.33
36 0.27
37 0.23
38 0.19
39 0.14
40 0.11
41 0.12
42 0.13
43 0.13
44 0.2
45 0.21
46 0.25
47 0.27
48 0.28
49 0.34
50 0.35
51 0.35
52 0.3
53 0.28
54 0.22
55 0.2
56 0.18
57 0.11
58 0.08
59 0.06
60 0.05
61 0.05
62 0.05
63 0.05
64 0.05
65 0.05
66 0.05
67 0.05
68 0.05
69 0.05
70 0.05
71 0.05
72 0.05
73 0.06
74 0.07
75 0.07
76 0.09
77 0.09
78 0.09
79 0.09
80 0.09
81 0.08
82 0.08
83 0.09
84 0.07
85 0.07
86 0.07
87 0.07
88 0.09
89 0.09
90 0.09
91 0.09
92 0.1
93 0.16
94 0.18
95 0.18
96 0.16
97 0.16
98 0.16
99 0.15
100 0.13
101 0.06
102 0.04
103 0.03
104 0.03
105 0.02
106 0.02
107 0.02
108 0.02
109 0.02
110 0.02
111 0.02
112 0.02
113 0.03
114 0.03
115 0.03
116 0.04
117 0.04
118 0.05
119 0.06
120 0.05
121 0.05
122 0.06
123 0.07
124 0.06
125 0.07
126 0.06
127 0.05
128 0.06
129 0.06
130 0.05
131 0.04
132 0.04
133 0.04
134 0.04
135 0.04
136 0.03
137 0.04
138 0.04
139 0.07
140 0.11
141 0.13
142 0.17
143 0.2
144 0.24
145 0.27
146 0.37
147 0.46
148 0.52
149 0.62
150 0.69
151 0.75
152 0.8
153 0.86
154 0.86
155 0.81
156 0.81
157 0.8
158 0.76
159 0.75
160 0.77
161 0.7
162 0.64
163 0.59
164 0.55
165 0.53
166 0.5
167 0.43
168 0.35
169 0.34
170 0.3
171 0.3
172 0.23
173 0.15
174 0.14
175 0.13
176 0.11
177 0.09
178 0.09
179 0.08
180 0.08
181 0.07
182 0.05
183 0.04
184 0.05
185 0.05
186 0.05
187 0.06
188 0.06
189 0.07
190 0.08
191 0.08
192 0.08
193 0.09
194 0.08