Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C2SBK6

Protein Details
Accession A0A5C2SBK6   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
7-28WGLLPGKRALRRRPRLRTTFIMHydrophilic
NLS Segment(s)
PositionSequence
13-21KRALRRRPR
Subcellular Location(s) cyto 6, mito 11, mito_nucl 6, plas 7
Family & Domain DBs
Amino Acid Sequences MPYNGHWGLLPGKRALRRRPRLRTTFIMPVNRRLGHRKSAQCSAPRLMLNANSDIALVVVSFALVLARPMRVLFILTLTVP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.52
3 0.57
4 0.64
5 0.72
6 0.79
7 0.83
8 0.84
9 0.83
10 0.78
11 0.73
12 0.71
13 0.66
14 0.65
15 0.57
16 0.56
17 0.54
18 0.5
19 0.47
20 0.44
21 0.42
22 0.4
23 0.46
24 0.46
25 0.44
26 0.48
27 0.5
28 0.47
29 0.47
30 0.42
31 0.38
32 0.32
33 0.28
34 0.24
35 0.23
36 0.21
37 0.19
38 0.17
39 0.13
40 0.13
41 0.12
42 0.1
43 0.07
44 0.05
45 0.04
46 0.03
47 0.03
48 0.03
49 0.03
50 0.03
51 0.03
52 0.04
53 0.05
54 0.06
55 0.07
56 0.07
57 0.08
58 0.09
59 0.1
60 0.09
61 0.1