Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C2SJW2

Protein Details
Accession A0A5C2SJW2    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
12-44KVKSQTPKVEKQEKKKVPKGRAKKRMLYNRRFVBasic
NLS Segment(s)
PositionSequence
12-37KVKSQTPKVEKQEKKKVPKGRAKKRM
Subcellular Location(s) mito 14, nucl 8.5, cyto_nucl 7, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MLFHGSLARAGKVKSQTPKVEKQEKKKVPKGRAKKRMLYNRRFVNVTTLPGGKRRMNANPEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.43
3 0.5
4 0.54
5 0.63
6 0.66
7 0.71
8 0.72
9 0.74
10 0.77
11 0.78
12 0.81
13 0.8
14 0.79
15 0.79
16 0.81
17 0.82
18 0.82
19 0.84
20 0.81
21 0.81
22 0.82
23 0.83
24 0.83
25 0.8
26 0.78
27 0.75
28 0.72
29 0.65
30 0.55
31 0.53
32 0.45
33 0.4
34 0.34
35 0.3
36 0.28
37 0.31
38 0.36
39 0.31
40 0.33
41 0.37
42 0.42