Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C2S6S2

Protein Details
Accession A0A5C2S6S2    Localization Confidence Low Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
58-84DRSHLARRSCPRRSRPKTRYYCPFRLTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, nucl 10, cyto_nucl 7.5
Family & Domain DBs
Amino Acid Sequences MRSRSRKCAIKVYWCKGHESVNGEAFPSAYRGCSATVETSVGTRIHDASRGQPRQVVDRSHLARRSCPRRSRPKTRYYCPFRLTYSKVLYCNAQARTSLYVDPIANRPCAAVSLCGKYFRNRTVKRTYTQYPRRGVPMPAHEIHPLSRENGAFFREKQRLSVVRSTFPVRKSRLPMQSCTVQAAQQRETCVPIRDESAKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.7
3 0.61
4 0.6
5 0.54
6 0.48
7 0.45
8 0.4
9 0.39
10 0.34
11 0.32
12 0.26
13 0.21
14 0.19
15 0.14
16 0.09
17 0.1
18 0.11
19 0.12
20 0.13
21 0.14
22 0.14
23 0.15
24 0.15
25 0.14
26 0.14
27 0.15
28 0.14
29 0.12
30 0.12
31 0.12
32 0.12
33 0.15
34 0.16
35 0.22
36 0.32
37 0.34
38 0.33
39 0.35
40 0.35
41 0.39
42 0.43
43 0.38
44 0.31
45 0.37
46 0.4
47 0.43
48 0.47
49 0.41
50 0.43
51 0.5
52 0.56
53 0.56
54 0.62
55 0.65
56 0.72
57 0.8
58 0.84
59 0.83
60 0.85
61 0.85
62 0.84
63 0.85
64 0.82
65 0.81
66 0.73
67 0.67
68 0.6
69 0.57
70 0.53
71 0.49
72 0.45
73 0.4
74 0.38
75 0.35
76 0.32
77 0.29
78 0.3
79 0.26
80 0.21
81 0.18
82 0.19
83 0.2
84 0.2
85 0.18
86 0.12
87 0.13
88 0.12
89 0.13
90 0.16
91 0.15
92 0.14
93 0.14
94 0.13
95 0.11
96 0.12
97 0.11
98 0.1
99 0.11
100 0.14
101 0.15
102 0.18
103 0.19
104 0.22
105 0.26
106 0.3
107 0.39
108 0.39
109 0.45
110 0.52
111 0.56
112 0.55
113 0.58
114 0.58
115 0.58
116 0.64
117 0.65
118 0.6
119 0.57
120 0.58
121 0.54
122 0.49
123 0.45
124 0.42
125 0.4
126 0.37
127 0.37
128 0.34
129 0.32
130 0.3
131 0.27
132 0.21
133 0.17
134 0.19
135 0.17
136 0.18
137 0.18
138 0.2
139 0.2
140 0.21
141 0.28
142 0.31
143 0.31
144 0.31
145 0.37
146 0.4
147 0.43
148 0.49
149 0.44
150 0.41
151 0.44
152 0.48
153 0.45
154 0.45
155 0.47
156 0.44
157 0.48
158 0.52
159 0.58
160 0.62
161 0.61
162 0.61
163 0.59
164 0.6
165 0.54
166 0.52
167 0.44
168 0.37
169 0.38
170 0.39
171 0.37
172 0.34
173 0.36
174 0.32
175 0.35
176 0.35
177 0.35
178 0.32
179 0.3
180 0.32