Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C2RWD0

Protein Details
Accession A0A5C2RWD0   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
61-84AGPSRQGVRARWRRRRGTAWKSSVHydrophilic
NLS Segment(s)
PositionSequence
69-77RARWRRRRG
Subcellular Location(s) cyto 3, extr 18, mito 4
Family & Domain DBs
Amino Acid Sequences MCSPVRAHEGTCTPRLRLSLSASVAFASSGTFVQPCAAGARRGASGRRWWEQYSNYIGAFAGPSRQGVRARWRRRRGTAWKSSV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.37
3 0.34
4 0.3
5 0.31
6 0.3
7 0.3
8 0.3
9 0.27
10 0.26
11 0.23
12 0.19
13 0.14
14 0.07
15 0.06
16 0.05
17 0.05
18 0.05
19 0.05
20 0.06
21 0.06
22 0.06
23 0.08
24 0.09
25 0.09
26 0.09
27 0.11
28 0.12
29 0.13
30 0.14
31 0.14
32 0.19
33 0.23
34 0.26
35 0.28
36 0.29
37 0.32
38 0.33
39 0.34
40 0.33
41 0.3
42 0.27
43 0.24
44 0.22
45 0.18
46 0.16
47 0.12
48 0.09
49 0.08
50 0.09
51 0.11
52 0.15
53 0.18
54 0.22
55 0.33
56 0.42
57 0.52
58 0.62
59 0.7
60 0.75
61 0.81
62 0.87
63 0.87
64 0.87