Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C2SIE1

Protein Details
Accession A0A5C2SIE1    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
86-120KPELKNKQKRHEGEARPRLRYKKRCTCIGQHDNQHBasic
NLS Segment(s)
PositionSequence
74-108TPLARGPFNGAPKPELKNKQKRHEGEARPRLRYKK
Subcellular Location(s) nucl 12.5, mito 12, cyto_nucl 7.5
Family & Domain DBs
Amino Acid Sequences MTPLSSSDSLLSCRSRIPRKHTTVRTHMLRHSPVPSQRPTQTNFDIGHPAKHPANRHLRMTRGHCQTDRSARKTPLARGPFNGAPKPELKNKQKRHEGEARPRLRYKKRCTCIGQHDNQH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.39
3 0.45
4 0.51
5 0.58
6 0.65
7 0.75
8 0.78
9 0.79
10 0.78
11 0.79
12 0.78
13 0.72
14 0.68
15 0.64
16 0.59
17 0.53
18 0.47
19 0.45
20 0.44
21 0.45
22 0.44
23 0.42
24 0.44
25 0.45
26 0.45
27 0.45
28 0.41
29 0.4
30 0.37
31 0.33
32 0.36
33 0.32
34 0.31
35 0.26
36 0.27
37 0.24
38 0.27
39 0.27
40 0.28
41 0.38
42 0.38
43 0.43
44 0.43
45 0.44
46 0.46
47 0.5
48 0.5
49 0.46
50 0.46
51 0.41
52 0.41
53 0.42
54 0.47
55 0.48
56 0.45
57 0.46
58 0.44
59 0.5
60 0.51
61 0.51
62 0.5
63 0.49
64 0.45
65 0.41
66 0.46
67 0.44
68 0.44
69 0.42
70 0.34
71 0.3
72 0.32
73 0.34
74 0.36
75 0.42
76 0.48
77 0.56
78 0.64
79 0.72
80 0.79
81 0.78
82 0.78
83 0.79
84 0.79
85 0.79
86 0.8
87 0.76
88 0.74
89 0.77
90 0.78
91 0.78
92 0.78
93 0.78
94 0.78
95 0.79
96 0.81
97 0.81
98 0.82
99 0.82
100 0.82