Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C2SB99

Protein Details
Accession A0A5C2SB99   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
103-126QERALWRGRGKREAKRRQGRLDDGBasic
NLS Segment(s)
PositionSequence
109-121RGRGKREAKRRQG
Subcellular Location(s) cyto 6, extr 7, mito 12
Family & Domain DBs
Amino Acid Sequences MASDPRGLWGLCLLLDCFGAPLRPPCLSETSRIFASVSMSPALRRALAAMARVPGAGVGLENAGCDMVGSGGALVPSKFCACGRLRRGVDGMMFVAKTVATPQERALWRGRGKREAKRRQGRLDDG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.1
3 0.09
4 0.08
5 0.08
6 0.09
7 0.09
8 0.13
9 0.15
10 0.16
11 0.18
12 0.19
13 0.25
14 0.26
15 0.29
16 0.31
17 0.31
18 0.3
19 0.3
20 0.27
21 0.21
22 0.23
23 0.19
24 0.16
25 0.13
26 0.13
27 0.12
28 0.14
29 0.14
30 0.11
31 0.1
32 0.09
33 0.11
34 0.12
35 0.13
36 0.12
37 0.11
38 0.11
39 0.11
40 0.1
41 0.07
42 0.06
43 0.05
44 0.03
45 0.03
46 0.03
47 0.03
48 0.03
49 0.03
50 0.03
51 0.03
52 0.03
53 0.02
54 0.02
55 0.02
56 0.02
57 0.02
58 0.03
59 0.03
60 0.03
61 0.03
62 0.04
63 0.05
64 0.05
65 0.06
66 0.06
67 0.12
68 0.15
69 0.24
70 0.29
71 0.37
72 0.38
73 0.39
74 0.4
75 0.37
76 0.34
77 0.26
78 0.23
79 0.15
80 0.14
81 0.11
82 0.1
83 0.08
84 0.07
85 0.07
86 0.12
87 0.12
88 0.14
89 0.15
90 0.24
91 0.25
92 0.29
93 0.33
94 0.36
95 0.42
96 0.49
97 0.54
98 0.56
99 0.63
100 0.7
101 0.75
102 0.78
103 0.82
104 0.84
105 0.87
106 0.87