Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C2S3Z4

Protein Details
Accession A0A5C2S3Z4    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
140-164WTVLRGRSCTRSRKRTLSRGRTSASHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11, mito 11, mito_nucl 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR027486  Ribosomal_S10_dom  
IPR036838  Ribosomal_S10_dom_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF00338  Ribosomal_S10  
Amino Acid Sequences MIYRYLALMNVRQILQWTSALSGAVKLCFNAPPGNRDPKLKPTDLLLQRVHLPGRPPRSAATSNSQIQRTQRVSYTDGASDNPTTSPKRTASPPRPSNSAPTTVHPRTFDFFVPFASHTASALGMPLSKLVHLPTQRRLWTVLRGRSCTRSRKRTLSRGRTSAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.21
3 0.19
4 0.16
5 0.14
6 0.15
7 0.15
8 0.13
9 0.14
10 0.13
11 0.13
12 0.13
13 0.12
14 0.13
15 0.13
16 0.15
17 0.19
18 0.2
19 0.24
20 0.3
21 0.39
22 0.4
23 0.44
24 0.46
25 0.49
26 0.54
27 0.49
28 0.44
29 0.39
30 0.47
31 0.46
32 0.48
33 0.39
34 0.35
35 0.35
36 0.37
37 0.33
38 0.25
39 0.25
40 0.26
41 0.31
42 0.31
43 0.3
44 0.29
45 0.34
46 0.35
47 0.34
48 0.34
49 0.33
50 0.36
51 0.38
52 0.38
53 0.34
54 0.33
55 0.37
56 0.33
57 0.29
58 0.27
59 0.26
60 0.27
61 0.28
62 0.27
63 0.21
64 0.19
65 0.18
66 0.17
67 0.14
68 0.12
69 0.1
70 0.12
71 0.12
72 0.13
73 0.16
74 0.16
75 0.18
76 0.24
77 0.34
78 0.41
79 0.5
80 0.56
81 0.55
82 0.58
83 0.57
84 0.57
85 0.49
86 0.46
87 0.37
88 0.34
89 0.4
90 0.37
91 0.39
92 0.34
93 0.34
94 0.3
95 0.3
96 0.28
97 0.23
98 0.21
99 0.19
100 0.2
101 0.18
102 0.17
103 0.16
104 0.15
105 0.12
106 0.12
107 0.11
108 0.08
109 0.08
110 0.07
111 0.06
112 0.06
113 0.07
114 0.07
115 0.07
116 0.08
117 0.09
118 0.15
119 0.21
120 0.26
121 0.32
122 0.39
123 0.41
124 0.42
125 0.45
126 0.42
127 0.46
128 0.5
129 0.52
130 0.5
131 0.54
132 0.56
133 0.61
134 0.65
135 0.66
136 0.68
137 0.69
138 0.71
139 0.77
140 0.82
141 0.85
142 0.88
143 0.89
144 0.88