Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C2SRW1

Protein Details
Accession A0A5C2SRW1   
Localization Confidence Low
Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
30-51TGRRTCTTRSRKAEVRTRRRSGHydrophilic
NLS Segment(s)
PositionSequence
48-48R
Subcellular Location(s) cyto 10.5, cyto_nucl 8.5, extr 2, mito 7, nucl 5.5, plas 2
Family & Domain DBs
Amino Acid Sequences MPVFRDASPGLNIMLETILTMPHPPLGDSTGRRTCTTRSRKAEVRTRRRSGLTRPRSSAHPPSSNISHPTTALCAAHLPQTAAPPGPDPVATSSYRPWSVHVSTGGGNFARPSAIRPDRSRPLSCILSLHRGVASRPHAHTHTHAQQRARAPPSFASATASPACTTDGRRDNRGGGTRAESNIFASSWNSESRSGHPTVLRGRSHSIFAGLGGRVGARAGITIHPGSELGRDQTDRSWASSVRVPDWFVWAAPRDPGIVVSGAQDWRVRQGVARGKKAYRIMFVCTGDRITAIYSMSRSMSSRAGVVWGVMDTRANIH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.09
3 0.08
4 0.07
5 0.07
6 0.07
7 0.08
8 0.08
9 0.1
10 0.11
11 0.11
12 0.12
13 0.16
14 0.22
15 0.24
16 0.33
17 0.37
18 0.4
19 0.41
20 0.42
21 0.44
22 0.49
23 0.55
24 0.57
25 0.58
26 0.63
27 0.69
28 0.76
29 0.8
30 0.8
31 0.81
32 0.81
33 0.8
34 0.78
35 0.76
36 0.73
37 0.74
38 0.74
39 0.74
40 0.71
41 0.69
42 0.65
43 0.64
44 0.66
45 0.65
46 0.62
47 0.57
48 0.52
49 0.53
50 0.55
51 0.53
52 0.5
53 0.43
54 0.36
55 0.3
56 0.28
57 0.25
58 0.22
59 0.19
60 0.15
61 0.13
62 0.13
63 0.16
64 0.16
65 0.15
66 0.14
67 0.16
68 0.17
69 0.16
70 0.16
71 0.13
72 0.13
73 0.13
74 0.12
75 0.11
76 0.12
77 0.16
78 0.16
79 0.17
80 0.18
81 0.22
82 0.25
83 0.24
84 0.23
85 0.25
86 0.26
87 0.27
88 0.25
89 0.23
90 0.21
91 0.22
92 0.21
93 0.15
94 0.14
95 0.11
96 0.1
97 0.09
98 0.07
99 0.09
100 0.16
101 0.22
102 0.28
103 0.32
104 0.39
105 0.46
106 0.52
107 0.51
108 0.45
109 0.45
110 0.41
111 0.37
112 0.34
113 0.28
114 0.28
115 0.27
116 0.25
117 0.2
118 0.19
119 0.19
120 0.21
121 0.23
122 0.22
123 0.23
124 0.25
125 0.25
126 0.26
127 0.29
128 0.31
129 0.34
130 0.38
131 0.4
132 0.38
133 0.42
134 0.44
135 0.48
136 0.44
137 0.37
138 0.31
139 0.29
140 0.31
141 0.27
142 0.23
143 0.19
144 0.15
145 0.17
146 0.16
147 0.15
148 0.12
149 0.11
150 0.12
151 0.11
152 0.12
153 0.16
154 0.23
155 0.26
156 0.29
157 0.3
158 0.3
159 0.34
160 0.37
161 0.32
162 0.25
163 0.26
164 0.24
165 0.24
166 0.23
167 0.19
168 0.15
169 0.14
170 0.12
171 0.1
172 0.09
173 0.09
174 0.1
175 0.11
176 0.11
177 0.12
178 0.14
179 0.17
180 0.21
181 0.21
182 0.22
183 0.22
184 0.24
185 0.28
186 0.34
187 0.31
188 0.29
189 0.32
190 0.31
191 0.32
192 0.28
193 0.23
194 0.16
195 0.16
196 0.16
197 0.11
198 0.1
199 0.08
200 0.08
201 0.07
202 0.07
203 0.06
204 0.03
205 0.04
206 0.05
207 0.06
208 0.09
209 0.09
210 0.09
211 0.09
212 0.09
213 0.09
214 0.1
215 0.11
216 0.1
217 0.12
218 0.13
219 0.14
220 0.15
221 0.21
222 0.2
223 0.2
224 0.21
225 0.2
226 0.22
227 0.25
228 0.26
229 0.23
230 0.24
231 0.23
232 0.21
233 0.25
234 0.22
235 0.18
236 0.2
237 0.2
238 0.19
239 0.18
240 0.18
241 0.15
242 0.14
243 0.15
244 0.13
245 0.11
246 0.1
247 0.1
248 0.13
249 0.12
250 0.14
251 0.15
252 0.14
253 0.18
254 0.19
255 0.18
256 0.17
257 0.25
258 0.33
259 0.4
260 0.48
261 0.49
262 0.5
263 0.56
264 0.62
265 0.57
266 0.54
267 0.48
268 0.46
269 0.47
270 0.47
271 0.43
272 0.37
273 0.35
274 0.27
275 0.25
276 0.2
277 0.15
278 0.14
279 0.13
280 0.13
281 0.13
282 0.14
283 0.15
284 0.16
285 0.16
286 0.18
287 0.2
288 0.19
289 0.19
290 0.17
291 0.18
292 0.17
293 0.16
294 0.14
295 0.11
296 0.11
297 0.11
298 0.11