Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C2SRU6

Protein Details
Accession A0A5C2SRU6    Localization Confidence Low Confidence Score 7.2
NoLS Segment(s)
PositionSequenceProtein Nature
100-125LHFAPPPNWHRRPRFRLRPPRFSFLSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18, nucl 6.5, cyto_nucl 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006721  ATP_synth_F1_esu_mt  
IPR036742  ATP_synth_F1_esu_sf_mt  
Gene Ontology GO:0000275  C:mitochondrial proton-transporting ATP synthase complex, catalytic sector F(1)  
GO:0046933  F:proton-transporting ATP synthase activity, rotational mechanism  
Pfam View protein in Pfam  
PF04627  ATP-synt_Eps  
CDD cd12153  F1-ATPase_epsilon  
Amino Acid Sequences MSSATWRNVFTYNKYTQIAARALRASLKEEERVAAEKRGLTILRYQHWQHGQGGPQVRPILRSPSTTRLLTASSFPLSPSLVLYQCLSRCCDLPHSKTPLHFAPPPNWHRRPRFRLRPPRFSFLSLPAQSQTYLYPPEEAAPKKPAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.4
3 0.36
4 0.38
5 0.37
6 0.31
7 0.32
8 0.27
9 0.27
10 0.29
11 0.28
12 0.26
13 0.26
14 0.27
15 0.26
16 0.25
17 0.26
18 0.25
19 0.27
20 0.25
21 0.23
22 0.22
23 0.2
24 0.2
25 0.22
26 0.2
27 0.18
28 0.21
29 0.23
30 0.24
31 0.28
32 0.28
33 0.31
34 0.34
35 0.35
36 0.33
37 0.32
38 0.31
39 0.32
40 0.35
41 0.29
42 0.29
43 0.28
44 0.26
45 0.24
46 0.23
47 0.25
48 0.22
49 0.25
50 0.25
51 0.3
52 0.33
53 0.31
54 0.3
55 0.25
56 0.24
57 0.21
58 0.19
59 0.14
60 0.11
61 0.11
62 0.1
63 0.1
64 0.09
65 0.08
66 0.08
67 0.08
68 0.08
69 0.09
70 0.09
71 0.11
72 0.13
73 0.14
74 0.15
75 0.14
76 0.14
77 0.15
78 0.23
79 0.26
80 0.31
81 0.37
82 0.41
83 0.42
84 0.42
85 0.45
86 0.4
87 0.39
88 0.38
89 0.33
90 0.35
91 0.43
92 0.49
93 0.54
94 0.58
95 0.62
96 0.67
97 0.75
98 0.77
99 0.79
100 0.83
101 0.84
102 0.88
103 0.89
104 0.91
105 0.87
106 0.84
107 0.76
108 0.7
109 0.62
110 0.57
111 0.58
112 0.48
113 0.43
114 0.37
115 0.35
116 0.31
117 0.28
118 0.23
119 0.17
120 0.19
121 0.18
122 0.18
123 0.17
124 0.21
125 0.27
126 0.28
127 0.3