Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C2SCJ7

Protein Details
Accession A0A5C2SCJ7    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
30-50AGENRRRSKGWKRRGKYAGNTBasic
NLS Segment(s)
PositionSequence
34-45RRRSKGWKRRGK
Subcellular Location(s) extr 10, mito 7, cyto 6, nucl 1, plas 1, pero 1, E.R. 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MGLPLRLARSNKERAYVALADSDASLRAVAGENRRRSKGWKRRGKYAGNTSLSRVQGSESEQSAEQPRVIARWVATRCTGSRARPPGSRAKKVTQSRPLLAAAPAVAAGLLLAVSLVLHIVDARTGRTGDGKGLYLYAGVGRGYHAACLVSSPPLAQI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.46
3 0.4
4 0.33
5 0.26
6 0.24
7 0.19
8 0.18
9 0.17
10 0.11
11 0.09
12 0.08
13 0.06
14 0.06
15 0.08
16 0.12
17 0.2
18 0.28
19 0.36
20 0.42
21 0.45
22 0.45
23 0.51
24 0.58
25 0.6
26 0.63
27 0.65
28 0.65
29 0.73
30 0.8
31 0.81
32 0.79
33 0.78
34 0.77
35 0.71
36 0.67
37 0.59
38 0.56
39 0.48
40 0.39
41 0.29
42 0.2
43 0.17
44 0.19
45 0.19
46 0.14
47 0.15
48 0.14
49 0.16
50 0.17
51 0.16
52 0.13
53 0.11
54 0.11
55 0.1
56 0.11
57 0.1
58 0.08
59 0.15
60 0.16
61 0.16
62 0.17
63 0.18
64 0.18
65 0.22
66 0.25
67 0.2
68 0.26
69 0.31
70 0.33
71 0.35
72 0.38
73 0.44
74 0.49
75 0.53
76 0.5
77 0.5
78 0.56
79 0.59
80 0.65
81 0.63
82 0.6
83 0.55
84 0.52
85 0.48
86 0.4
87 0.33
88 0.25
89 0.15
90 0.1
91 0.09
92 0.06
93 0.05
94 0.03
95 0.03
96 0.02
97 0.02
98 0.02
99 0.02
100 0.02
101 0.02
102 0.02
103 0.02
104 0.02
105 0.02
106 0.02
107 0.03
108 0.04
109 0.05
110 0.06
111 0.08
112 0.09
113 0.09
114 0.13
115 0.13
116 0.15
117 0.17
118 0.17
119 0.16
120 0.16
121 0.15
122 0.12
123 0.11
124 0.09
125 0.08
126 0.07
127 0.07
128 0.07
129 0.1
130 0.1
131 0.1
132 0.11
133 0.1
134 0.1
135 0.12
136 0.12
137 0.12
138 0.12