Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C2SC09

Protein Details
Accession A0A5C2SC09   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
3-28FTYAPDFVVKRRRRRSRQPVDPCLGFHydrophilic
NLS Segment(s)
PositionSequence
13-17RRRRR
Subcellular Location(s) cyto_nucl 4.5, mito 20, nucl 6
Family & Domain DBs
Amino Acid Sequences MAFTYAPDFVVKRRRRRSRQPVDPCLGFYEDIPTSPSIPLSASTPVRTVCSSEPIEEVHTVDLYGPNNPGDDDAGVRQRLSVAPPDSDSPAGIQTPVLLDKDANEPLTVEQFLRRAATTTSGKTPREY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.74
3 0.84
4 0.9
5 0.91
6 0.93
7 0.93
8 0.92
9 0.88
10 0.79
11 0.69
12 0.61
13 0.51
14 0.4
15 0.29
16 0.24
17 0.17
18 0.16
19 0.17
20 0.14
21 0.14
22 0.14
23 0.14
24 0.09
25 0.1
26 0.1
27 0.1
28 0.14
29 0.14
30 0.15
31 0.16
32 0.16
33 0.17
34 0.17
35 0.18
36 0.14
37 0.18
38 0.18
39 0.18
40 0.18
41 0.17
42 0.18
43 0.16
44 0.15
45 0.1
46 0.09
47 0.08
48 0.07
49 0.09
50 0.07
51 0.08
52 0.08
53 0.07
54 0.08
55 0.08
56 0.08
57 0.06
58 0.06
59 0.06
60 0.08
61 0.11
62 0.11
63 0.11
64 0.1
65 0.11
66 0.11
67 0.12
68 0.16
69 0.15
70 0.15
71 0.17
72 0.19
73 0.2
74 0.19
75 0.18
76 0.13
77 0.13
78 0.12
79 0.1
80 0.09
81 0.07
82 0.08
83 0.1
84 0.09
85 0.08
86 0.08
87 0.1
88 0.14
89 0.16
90 0.15
91 0.14
92 0.14
93 0.15
94 0.18
95 0.17
96 0.14
97 0.14
98 0.15
99 0.16
100 0.17
101 0.17
102 0.16
103 0.16
104 0.23
105 0.25
106 0.28
107 0.36
108 0.41