Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C2SV23

Protein Details
Accession A0A5C2SV23    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
81-123PLDLRPKKTRAIRRRLTKHEASLKTLKQRKKDIHFPIRKYAVKHydrophilic
NLS Segment(s)
PositionSequence
84-118LRPKKTRAIRRRLTKHEASLKTLKQRKKDIHFPIR
Subcellular Location(s) nucl 22.5, cyto_nucl 13, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR018254  Ribosomal_L29_CS  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
PROSITE View protein in PROSITE  
PS00579  RIBOSOMAL_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MPGKVKAYELQSKSKNDLSKQLTELKTELLALRVQKIAGGSAAKLTKINTVRKSIARVLTVMNQKQRQNLREFYKNKKYLPLDLRPKKTRAIRRRLTKHEASLKTLKQRKKDIHFPIRKYAVKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.55
3 0.48
4 0.54
5 0.5
6 0.49
7 0.48
8 0.52
9 0.48
10 0.44
11 0.42
12 0.34
13 0.29
14 0.24
15 0.21
16 0.14
17 0.15
18 0.13
19 0.15
20 0.14
21 0.13
22 0.13
23 0.13
24 0.12
25 0.11
26 0.11
27 0.08
28 0.11
29 0.12
30 0.12
31 0.12
32 0.12
33 0.17
34 0.22
35 0.29
36 0.29
37 0.33
38 0.36
39 0.37
40 0.41
41 0.39
42 0.36
43 0.29
44 0.27
45 0.23
46 0.26
47 0.3
48 0.28
49 0.3
50 0.31
51 0.32
52 0.37
53 0.41
54 0.39
55 0.39
56 0.43
57 0.44
58 0.48
59 0.52
60 0.55
61 0.6
62 0.61
63 0.57
64 0.58
65 0.55
66 0.54
67 0.56
68 0.57
69 0.58
70 0.62
71 0.7
72 0.66
73 0.66
74 0.65
75 0.67
76 0.68
77 0.67
78 0.69
79 0.7
80 0.76
81 0.83
82 0.85
83 0.84
84 0.8
85 0.78
86 0.78
87 0.71
88 0.67
89 0.66
90 0.62
91 0.64
92 0.66
93 0.63
94 0.61
95 0.68
96 0.71
97 0.72
98 0.77
99 0.77
100 0.81
101 0.84
102 0.81
103 0.82
104 0.81