Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C2S140

Protein Details
Accession A0A5C2S140    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
10-33GGDATKKTAKPKRKTSNAGSRKKLHydrophilic
NLS Segment(s)
PositionSequence
15-32KKTAKPKRKTSNAGSRKK
Subcellular Location(s) nucl 19, mito_nucl 13, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036910  HMG_box_dom_sf  
IPR006780  YABBY  
Gene Ontology GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF04690  YABBY  
Amino Acid Sequences MVVTTKQAAGGDATKKTAKPKRKTSNAGSRKKLTEFNKFMQTEVARLKQENPDMPHKDRFKLVINNWNKQKEAQSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.26
3 0.35
4 0.41
5 0.46
6 0.52
7 0.62
8 0.69
9 0.77
10 0.83
11 0.82
12 0.85
13 0.85
14 0.85
15 0.8
16 0.74
17 0.67
18 0.62
19 0.6
20 0.53
21 0.53
22 0.49
23 0.46
24 0.5
25 0.47
26 0.45
27 0.41
28 0.36
29 0.3
30 0.28
31 0.29
32 0.21
33 0.22
34 0.24
35 0.25
36 0.28
37 0.31
38 0.31
39 0.37
40 0.42
41 0.45
42 0.52
43 0.5
44 0.49
45 0.46
46 0.45
47 0.43
48 0.46
49 0.48
50 0.49
51 0.53
52 0.6
53 0.65
54 0.66
55 0.6
56 0.55