Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C2SSB7

Protein Details
Accession A0A5C2SSB7    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
35-54NAPFKKPYKMTKRTRKVGVTHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 21, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR002674  Ribosomal_L37ae  
IPR011331  Ribosomal_L37ae/L37e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01780  Ribosomal_L37ae  
Amino Acid Sequences MYYISTVAGGTVQFYPDLSRGSFHLPDNKDAAVLNAPFKKPYKMTKRTRKVGVTGKYGTRYGASLRKQIKKIEITQHARYTCTFCGKDAVKRQAVGIWNCKSCKKVIAGGAWTVSTTAAATVRSTVRRLRELTEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.11
3 0.12
4 0.14
5 0.12
6 0.13
7 0.14
8 0.2
9 0.23
10 0.23
11 0.3
12 0.3
13 0.33
14 0.34
15 0.32
16 0.27
17 0.24
18 0.23
19 0.18
20 0.17
21 0.19
22 0.21
23 0.22
24 0.24
25 0.26
26 0.28
27 0.28
28 0.37
29 0.43
30 0.49
31 0.59
32 0.67
33 0.76
34 0.79
35 0.82
36 0.76
37 0.72
38 0.71
39 0.66
40 0.61
41 0.54
42 0.49
43 0.44
44 0.4
45 0.33
46 0.25
47 0.2
48 0.17
49 0.21
50 0.2
51 0.25
52 0.32
53 0.38
54 0.4
55 0.41
56 0.44
57 0.41
58 0.44
59 0.46
60 0.48
61 0.48
62 0.5
63 0.53
64 0.48
65 0.45
66 0.41
67 0.36
68 0.29
69 0.3
70 0.25
71 0.2
72 0.26
73 0.27
74 0.33
75 0.38
76 0.43
77 0.39
78 0.39
79 0.39
80 0.37
81 0.41
82 0.38
83 0.37
84 0.35
85 0.37
86 0.39
87 0.4
88 0.38
89 0.34
90 0.34
91 0.29
92 0.3
93 0.31
94 0.35
95 0.36
96 0.36
97 0.35
98 0.3
99 0.27
100 0.21
101 0.16
102 0.1
103 0.07
104 0.07
105 0.07
106 0.08
107 0.08
108 0.11
109 0.16
110 0.18
111 0.21
112 0.26
113 0.31
114 0.37
115 0.39