Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C2SCG9

Protein Details
Accession A0A5C2SCG9    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
39-63DDIPPRRPARHHHFRSRRRRITTCLBasic
NLS Segment(s)
PositionSequence
44-58RRPARHHHFRSRRRR
163-170KGTRKGKG
Subcellular Location(s) mito 13, plas 10, nucl 1, cyto 1, extr 1, cyto_nucl 1, vacu 1
Family & Domain DBs
Amino Acid Sequences MLRPSPYRDFSVIAQHPLTSAKPSSTPHHRSIPPGFPSDDIPPRRPARHHHFRSRRRRITTCLSITSPAIAPRRGSLTLLPCVHDCHKASTCSITRPHAPCTCTVNYPLPLPVFPHLFYPFPVSRACPHFLLLLSLVRLCFSLAMRFSMTSATMTTVATRHGKGTRKGKGRAAVAIVSGPPRTQAAPHPWPDGPFFPSSFFDIHDLLYHWLPCLPPFRLLRVRTRTRVYRVVSVSSRFVTSCTSAI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.31
3 0.29
4 0.29
5 0.28
6 0.22
7 0.2
8 0.18
9 0.21
10 0.25
11 0.32
12 0.4
13 0.46
14 0.47
15 0.54
16 0.54
17 0.57
18 0.61
19 0.62
20 0.55
21 0.53
22 0.48
23 0.4
24 0.41
25 0.41
26 0.43
27 0.39
28 0.38
29 0.43
30 0.47
31 0.51
32 0.52
33 0.55
34 0.56
35 0.62
36 0.68
37 0.71
38 0.77
39 0.82
40 0.9
41 0.92
42 0.91
43 0.88
44 0.84
45 0.8
46 0.79
47 0.78
48 0.71
49 0.64
50 0.56
51 0.49
52 0.44
53 0.38
54 0.3
55 0.25
56 0.24
57 0.21
58 0.2
59 0.19
60 0.23
61 0.22
62 0.22
63 0.2
64 0.21
65 0.27
66 0.27
67 0.27
68 0.23
69 0.26
70 0.27
71 0.28
72 0.25
73 0.25
74 0.27
75 0.27
76 0.27
77 0.3
78 0.3
79 0.29
80 0.31
81 0.29
82 0.32
83 0.34
84 0.39
85 0.36
86 0.36
87 0.34
88 0.37
89 0.35
90 0.3
91 0.3
92 0.28
93 0.25
94 0.25
95 0.24
96 0.18
97 0.17
98 0.17
99 0.16
100 0.14
101 0.13
102 0.15
103 0.14
104 0.14
105 0.14
106 0.19
107 0.17
108 0.17
109 0.17
110 0.16
111 0.18
112 0.21
113 0.23
114 0.17
115 0.18
116 0.17
117 0.17
118 0.17
119 0.14
120 0.11
121 0.09
122 0.09
123 0.08
124 0.07
125 0.07
126 0.06
127 0.06
128 0.06
129 0.08
130 0.08
131 0.1
132 0.1
133 0.1
134 0.11
135 0.1
136 0.1
137 0.08
138 0.08
139 0.08
140 0.08
141 0.08
142 0.08
143 0.08
144 0.11
145 0.13
146 0.13
147 0.15
148 0.2
149 0.26
150 0.33
151 0.41
152 0.47
153 0.53
154 0.57
155 0.6
156 0.6
157 0.57
158 0.52
159 0.46
160 0.38
161 0.3
162 0.26
163 0.21
164 0.17
165 0.15
166 0.11
167 0.1
168 0.1
169 0.1
170 0.11
171 0.17
172 0.24
173 0.31
174 0.34
175 0.38
176 0.38
177 0.39
178 0.41
179 0.37
180 0.31
181 0.26
182 0.24
183 0.22
184 0.23
185 0.24
186 0.21
187 0.2
188 0.19
189 0.18
190 0.17
191 0.15
192 0.16
193 0.16
194 0.17
195 0.16
196 0.14
197 0.15
198 0.15
199 0.16
200 0.21
201 0.2
202 0.25
203 0.27
204 0.35
205 0.42
206 0.46
207 0.53
208 0.57
209 0.64
210 0.64
211 0.7
212 0.71
213 0.69
214 0.74
215 0.69
216 0.67
217 0.62
218 0.62
219 0.58
220 0.54
221 0.51
222 0.44
223 0.41
224 0.32
225 0.3
226 0.26